Protein Family IF00769
Metagenome
152
Members
47
Samples
152
Scaffolds
326.22
Avg Length
Representative Sequence
- ID
- 3300002462|JGI24702J35022_10006704|JGI24702J35022_100067043
- Length
- 321 aa
- Sequence
- MKKAIVLGGGGFIGSHLIKFLKDKDFWVKGVDLKYPMFSESVADEFIIGDLRDPDIVKSVLDYPYDEVYQLAADMGGAGYIFTGENDADVMHNSATINLNVLNYSKDVGVRKIFYSSSACIYPEYNQLDPDNPKCSEDSAYPAAPDSEYGWEKLFSERLYFAYKRNYGMNVKIARFHNIFGEEGTYDGGKEKAPAAICRKVAMTPDGGEIEIWGDGKQTRSFLYISECLKGIEKLMACETFDGPVNIGSDEMVSINQLAEKIIKISGKEIRLKHISGPLGVRGRNSDNHLIQEKLGWKPEKPLTFGLEITYDWINSMVKN*
Sample Types
Isolate
0.0%
Metagenome
100.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
45.5%
Kalotermitidae
31.8%
Rhinotermitidae
6.8%
Unclassified
6.8%
Termopsidae
4.5%
Armadillidiidae
4.5%
Taxonomy
Archaea
1
Bacteria
137
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 11 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 12 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 13 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 14 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 15 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 16 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 17 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 18 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 19 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 20 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 21 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 22 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 23 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 24 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 25 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 26 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 27 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 28 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 29 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 30 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 31 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 32 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 33 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 34 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 35 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 36 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 37 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 38 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 39 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 40 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 41 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 42 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 43 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 44 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 45 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 46 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 47 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466707_135040 | 3300042601 | Bacteria | 6183 |
| 2 | Ga0466707_341039 | 3300042601 | Bacteria | 1042 |
| 3 | Ga0466717_260438 | 3300042604 | Bacteria | 3685 |
| 4 | Ga0466690_015850 | 3300042590 | Bacteria | 1349 |
| 5 | Ga0466690_133196 | 3300042590 | Bacteria | 2382 |
| 6 | Ga0466690_243419 | 3300042590 | Bacteria | 10284 |
| 7 | Ga0466705_003189 | 3300042612 | Bacteria | 1993 |
| 8 | Ga0466705_039077 | 3300042612 | Bacteria | 41831 |
| 9 | Ga0466705_106547 | 3300042612 | Bacteria | 12868 |
| 10 | Ga0466709_228858 | 3300042648 | Bacteria | 27396 |
| 11 | Ga0466708_246218 | 3300042652 | Bacteria | 12061 |
| 12 | Ga0466727_318861 | 3300042655 | Bacteria | 1377 |
| 13 | Ga0466727_340254 | 3300042655 | Bacteria | 3420 |
| 14 | Ga0466711_106164 | 3300042615 | Bacteria | 1809 |
| 15 | Ga0466715_032161 | 3300042616 | Bacteria | 1924 |
| 16 | Ga0466715_408404 | 3300042616 | Bacteria | 4585 |
| 17 | Ga0466718_003438 | 3300042617 | Bacteria | 12488 |
| 18 | Ga0466728_031991 | 3300042620 | Bacteria | 25093 |
| 19 | JGI24702J35022_10028719 | 3300002462 | Bacteria | 2988 |
| 20 | Ga0068305_10013170 | 3300005083 | Bacteria | 17816 |
| 21 | Ga0072941_1127404 | 3300005201 | Unclassified | 4070 |
| 22 | Ga0466733_060411 | 3300042659 | Bacteria | 10084 |
| 23 | Ga0466720_129446 | 3300042607 | Bacteria | 11215 |
| 24 | Ga0160433_100008 | 3300012846 | Bacteria | 311360 |
| 25 | Ga0160443_100054 | 3300012848 | Bacteria | 237880 |
| 26 | Ga0264413_137300 | 3300024493 | Unclassified | 5114 |
| 27 | Ga0466691_017719 | 3300042593 | Bacteria | 3536 |
| 28 | Ga0466705_035522 | 3300042612 | Bacteria | 1864 |
| 29 | Ga0466705_381721 | 3300042612 | Bacteria | 4262 |
| 30 | Ga0466703_013406 | 3300042636 | Bacteria | 31137 |
| 31 | Ga0466703_135234 | 3300042636 | Unclassified | 1339 |
| 32 | Ga0466704_574923 | 3300042643 | Bacteria | 1954 |
| 33 | Ga0466704_613915 | 3300042643 | Bacteria | 2894 |
| 34 | Ga0466709_323589 | 3300042648 | Bacteria | 6181 |
| 35 | Ga0466708_294673 | 3300042652 | Bacteria | 3493 |
| 36 | Ga0466712_112671 | 3300042614 | Bacteria | 3914 |
| 37 | Ga0466711_074680 | 3300042615 | Bacteria | 29152 |
| 38 | Ga0466715_469646 | 3300042616 | Bacteria | 15443 |
| 39 | Ga0466718_133493 | 3300042617 | Bacteria | 1709 |
| 40 | Ga0466723_007804 | 3300042618 | Bacteria | 10079 |
| 41 | Ga0466723_013291 | 3300042618 | Bacteria | 9318 |
| 42 | Ga0466723_252260 | 3300042618 | Bacteria | 5289 |
| 43 | Ga0466726_056916 | 3300042619 | Unclassified | 17157 |
| 44 | Ga0466726_444538 | 3300042619 | Bacteria | 2151 |
| 45 | JGI24695J34938_10000176 | 3300002450 | Bacteria | 59497 |
| 46 | JGI24695J34938_10002113 | 3300002450 | Bacteria | 15559 |
| 47 | JGI24702J35022_10074623 | 3300002462 | Bacteria | 1831 |
| 48 | Ga0466700_247952 | 3300042600 | Bacteria | 1445 |
| 49 | Ga0466707_302433 | 3300042601 | Bacteria | 1183 |
| 50 | Ga0466707_306427 | 3300042601 | Bacteria | 1661 |
| 51 | Ga0466717_248134 | 3300042604 | Bacteria | 1515 |
| 52 | Ga0466716_448498 | 3300042605 | Bacteria | 2606 |
| 53 | Ga0466719_159545 | 3300042606 | Bacteria | 1693 |
| 54 | Ga0466698_089011 | 3300042610 | Bacteria | 3768 |
| 55 | Ga0160430_103739 | 3300012852 | Bacteria | 4070 |
| 56 | Ga0456237_0011524 | 3300041968 | Bacteria | 1290 |
| 57 | Ga0466691_047978 | 3300042593 | Bacteria | 9754 |
| 58 | Ga0466691_121537 | 3300042593 | Bacteria | 11235 |
| 59 | Ga0466705_107457 | 3300042612 | Bacteria | 2960 |
| 60 | Ga0466730_050483 | 3300042625 | Bacteria | 3772 |
| 61 | Ga0466704_375476 | 3300042643 | Bacteria | 2522 |
| 62 | Ga0466708_318761 | 3300042652 | Bacteria | 6749 |
| 63 | Ga0466715_363120 | 3300042616 | Bacteria | 3971 |
| 64 | Ga0466726_040172 | 3300042619 | Unclassified | 7042 |
| 65 | Ga0466726_185226 | 3300042619 | Bacteria | 5714 |
| 66 | Ga0466729_076386 | 3300042621 | Bacteria | 2165 |
| 67 | JGI24702J35022_10046588 | 3300002462 | Bacteria | 2308 |
| 68 | Ga0123357_10057463 | 3300009784 | Bacteria | 5228 |
| 69 | Ga0466713_048330 | 3300042602 | Bacteria | 17282 |
| 70 | Ga0466719_180410 | 3300042606 | Bacteria | 4472 |
| 71 | Ga0466692_145983 | 3300042591 | Bacteria | 1530 |
| 72 | Ga0466691_096660 | 3300042593 | Bacteria | 4239 |
| 73 | Ga0466708_310956 | 3300042652 | Bacteria | 3137 |
| 74 | Ga0466705_471682 | 3300042612 | Bacteria | 4123 |
| 75 | Ga0466712_301972 | 3300042614 | Archaea | 12210 |
| 76 | Ga0466728_246151 | 3300042620 | Bacteria | 5470 |
| 77 | JGI24697J35500_11274124 | 3300002507 | Bacteria | 6566 |
| 78 | Ga0466716_055236 | 3300042605 | Bacteria | 2505 |
| 79 | Ga0466719_043858 | 3300042606 | Bacteria | 23279 |
| 80 | Ga0466720_039429 | 3300042607 | Bacteria | 8601 |
| 81 | Ga0466690_028571 | 3300042590 | Bacteria | 6660 |
| 82 | Ga0466696_004225 | 3300042596 | Bacteria | 2136 |
| 83 | Ga0466696_049504 | 3300042596 | Bacteria | 7183 |
| 84 | Ga0466705_213055 | 3300042612 | Bacteria | 3960 |
| 85 | Ga0466705_220280 | 3300042612 | Bacteria | 3294 |
| 86 | Ga0466704_381790 | 3300042643 | Bacteria | 14332 |
| 87 | Ga0466708_329215 | 3300042652 | Bacteria | 19363 |
| 88 | Ga0466727_197667 | 3300042655 | Bacteria | 1466 |
| 89 | Ga0466712_139674 | 3300042614 | Bacteria | 11025 |
| 90 | Ga0466711_231288 | 3300042615 | Bacteria | 2896 |
| 91 | Ga0466711_391927 | 3300042615 | Bacteria | 2793 |
| 92 | Ga0466715_373081 | 3300042616 | Bacteria | 2427 |
| 93 | Ga0466718_126706 | 3300042617 | Bacteria | 1336 |
| 94 | Ga0466723_127162 | 3300042618 | Unclassified | 5671 |
| 95 | Ga0466726_302180 | 3300042619 | Unclassified | 3397 |
| 96 | JGI24698J34947_10042231 | 3300002449 | Bacteria | 2344 |
| 97 | Ga0072940_1129214 | 3300005200 | Bacteria | 1520 |
| 98 | Ga0466727_349740 | 3300042655 | Unclassified | 8619 |
| 99 | Ga0466732_135305 | 3300042656 | Unclassified | 2152 |
| 100 | Ga0466713_139981 | 3300042602 | Bacteria | 4019 |
| 101 | Ga0466716_067274 | 3300042605 | Bacteria | 16041 |
| 102 | Ga0466693_054427 | 3300042592 | Unclassified | 2160 |
| 103 | Ga0466691_076803 | 3300042593 | Bacteria | 26891 |
| 104 | Ga0466703_158061 | 3300042636 | Bacteria | 4160 |
| 105 | Ga0466704_167397 | 3300042643 | Bacteria | 4692 |
| 106 | Ga0466704_477832 | 3300042643 | Bacteria | 7936 |
| 107 | Ga0466704_486321 | 3300042643 | Bacteria | 2789 |
| 108 | Ga0466709_087743 | 3300042648 | Bacteria | 6314 |
| 109 | Ga0466709_165640 | 3300042648 | Bacteria | 10886 |
| 110 | Ga0466705_463000 | 3300042612 | Bacteria | 14210 |
| 111 | Ga0466711_046410 | 3300042615 | Bacteria | 2863 |
| 112 | Ga0466711_418453 | 3300042615 | Bacteria | 3158 |
| 113 | Ga0466723_203989 | 3300042618 | Bacteria | 3535 |
| 114 | Ga0466726_474491 | 3300042619 | Bacteria | 7557 |
| 115 | Ga0466713_105921 | 3300042602 | Bacteria | 3584 |
| 116 | Ga0466713_138185 | 3300042602 | Bacteria | 45604 |
| 117 | Ga0466657_367130 | 3300042582 | Bacteria | 2216 |
| 118 | Ga0466690_042634 | 3300042590 | Bacteria | 2337 |
| 119 | Ga0466690_132016 | 3300042590 | Bacteria | 8012 |
| 120 | Ga0466690_338998 | 3300042590 | Bacteria | 3901 |
| 121 | Ga0466696_427561 | 3300042596 | Bacteria | 2880 |
| 122 | Ga0466705_046438 | 3300042612 | Bacteria | 15962 |
| 123 | Ga0466705_150614 | 3300042612 | Unclassified | 3250 |
| 124 | Ga0466703_009463 | 3300042636 | Bacteria | 19190 |
| 125 | Ga0466703_017503 | 3300042636 | Bacteria | 4106 |
| 126 | Ga0466704_578964 | 3300042643 | Bacteria | 4352 |
| 127 | Ga0466708_149666 | 3300042652 | Bacteria | 12694 |
| 128 | Ga0466727_042949 | 3300042655 | Bacteria | 3573 |
| 129 | Ga0466715_611063 | 3300042616 | Bacteria | 1212 |
| 130 | Ga0466718_026316 | 3300042617 | Bacteria | 1447 |
| 131 | Ga0466718_087558 | 3300042617 | Bacteria | 3035 |
| 132 | Ga0466726_051654 | 3300042619 | Bacteria | 1604 |
| 133 | Ga0466726_166452 | 3300042619 | Bacteria | 12823 |
| 134 | Ga0466726_237352 | 3300042619 | Unclassified | 5467 |
| 135 | AustNasuHG_c1000203 | 3300000089 | Bacteria | 19564 |
| 136 | JGI24702J35022_10001382 | 3300002462 | Bacteria | 15081 |
| 137 | JGI24702J35022_10006704 | 3300002462 | Bacteria | 6641 |
| 138 | Ga0123355_10004926 | 3300009826 | Bacteria | 19432 |
| 139 | Ga0123353_10623972 | 3300010167 | Bacteria | 1534 |
| 140 | Ga0466716_524826 | 3300042605 | Bacteria | 1487 |
| 141 | Ga0264413_130353 | 3300024493 | Bacteria | 5421 |
| 142 | Ga0466690_063204 | 3300042590 | Unclassified | 2454 |
| 143 | Ga0466709_026203 | 3300042648 | Unclassified | 7350 |
| 144 | Ga0466708_284999 | 3300042652 | Bacteria | 28094 |
| 145 | Ga0466727_300886 | 3300042655 | Bacteria | 3141 |
| 146 | Ga0466727_305709 | 3300042655 | Bacteria | 1752 |
| 147 | Ga0466711_088026 | 3300042615 | Bacteria | 19290 |
| 148 | Ga0466715_312136 | 3300042616 | Bacteria | 7771 |
| 149 | Ga0466726_482459 | 3300042619 | Bacteria | 13117 |
| 150 | Ga0068305_10006407 | 3300005083 | Bacteria | 10456 |
| 151 | Ga0068305_10011939 | 3300005083 | Bacteria | 27751 |
| 152 | Ga0072941_1025687 | 3300005201 | Bacteria | 14903 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.