Protein Family IF00762
Metagenome
Isolate
244
Members
52
Samples
233
Scaffolds
169.14
Avg Length
Representative Sequence
- ID
- 3300002462|JGI24702J35022_10004127|JGI24702J35022_100041277
- Length
- 193 aa
- Sequence
- MDIPIITEATGNLIILIIENYPFSIQMNWFAAKVKYQTEKKVKEWFEEQSIEHFIPVRKIVVEKNGKRVEKEKILVPGLLFVHTDYQKALSLSAESKVKMVYMRNLESHQLLIVPDKQMQDFMFLLDFSETAIQIENTNLRQGDRVRVIKGEFAGIEGELIRIKGHKRVVIRLEGLFSLATTYIPSSYLERI*
Sample Types
Isolate
4.5%
Metagenome
95.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
31.4%
Kalotermitidae
27.5%
Unclassified
17.6%
Termopsidae
7.8%
Rhinotermitidae
5.9%
Passalidae
3.9%
Blattidae
3.9%
Hodotermitidae
2.0%
Taxonomy
Archaea
0
Bacteria
222
Eukaryota
0
Viruses
2
Unclassified
20
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 3 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 4 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 5 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 6 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 7 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 8 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 9 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 10 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 11 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 12 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 13 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 14 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 15 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 16 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 17 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 18 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 19 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 20 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 21 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 22 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 23 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 24 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 25 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 26 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 27 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 28 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 29 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 30 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 31 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 32 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 33 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 34 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 35 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 36 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 37 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 38 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 39 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 40 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 41 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 42 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 43 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 44 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 45 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 46 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 47 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 48 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 49 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 50 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 51 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 52 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_301897 | 3300042612 | Bacteria | 9487 |
| 2 | Ga0466657_298948 | 3300042582 | Bacteria | 1657 |
| 3 | Ga0466723_273364 | 3300042618 | Bacteria | 7459 |
| 4 | Ga0466726_000096 | 3300042619 | Unclassified | 1821 |
| 5 | Ga0466726_391894 | 3300042619 | Bacteria | 2502 |
| 6 | Ga0466728_012949 | 3300042620 | Bacteria | 24332 |
| 7 | JGI24699J35502_11134060 | 3300002509 | Bacteria | 27589 |
| 8 | Ga0466735_186902 | 3300042624 | Bacteria | 1913 |
| 9 | Ga0466735_197718 | 3300042624 | Bacteria | 3869 |
| 10 | Ga0466703_114203 | 3300042636 | Bacteria | 5057 |
| 11 | Ga0466703_187543 | 3300042636 | Unclassified | 1702 |
| 12 | Ga0466704_122514 | 3300042643 | Unclassified | 9225 |
| 13 | Ga0466704_489619 | 3300042643 | Bacteria | 8671 |
| 14 | Ga0466709_386991 | 3300042648 | Bacteria | 10728 |
| 15 | Ga0466707_179952 | 3300042601 | Bacteria | 7802 |
| 16 | Ga0466707_245048 | 3300042601 | Bacteria | 33561 |
| 17 | Ga0466713_135579 | 3300042602 | Bacteria | 5064 |
| 18 | Ga0466705_280119 | 3300042612 | Bacteria | 13925 |
| 19 | Ga0466690_052487 | 3300042590 | Bacteria | 6212 |
| 20 | Ga0466690_397813 | 3300042590 | Bacteria | 1885 |
| 21 | Ga0123357_10062842 | 3300009784 | Bacteria | 4967 |
| 22 | Ga0123357_10154150 | 3300009784 | Bacteria | 2777 |
| 23 | Ga0123354_10005342 | 3300010882 | Bacteria | 18635 |
| 24 | Ga0123354_10756783 | 3300010882 | Bacteria | 664 |
| 25 | Ga0466723_099283 | 3300042618 | Bacteria | 27764 |
| 26 | Ga0466723_338264 | 3300042618 | Bacteria | 1728 |
| 27 | JGI24696J40584_12926743 | 3300002834 | Bacteria | 1416 |
| 28 | Ga0068305_10007593 | 3300005083 | Bacteria | 80483 |
| 29 | Ga0072941_1348399 | 3300005201 | Bacteria | 1083 |
| 30 | Ga0123357_10001142 | 3300009784 | Bacteria | 27589 |
| 31 | Ga0466735_003222 | 3300042624 | Bacteria | 1952 |
| 32 | Ga0466735_086716 | 3300042624 | Bacteria | 8212 |
| 33 | Ga0466735_110644 | 3300042624 | Bacteria | 2433 |
| 34 | Ga0466735_115355 | 3300042624 | Bacteria | 1081 |
| 35 | Ga0466703_021069 | 3300042636 | Bacteria | 3537 |
| 36 | Ga0466703_033296 | 3300042636 | Unclassified | 5274 |
| 37 | Ga0466704_255301 | 3300042643 | Bacteria | 11916 |
| 38 | Ga0466704_477034 | 3300042643 | Bacteria | 56056 |
| 39 | Ga0466709_325671 | 3300042648 | Bacteria | 2247 |
| 40 | Ga0466708_149675 | 3300042652 | Bacteria | 2088 |
| 41 | Ga0466708_227378 | 3300042652 | Bacteria | 10885 |
| 42 | Ga0466706_042153 | 3300042599 | Bacteria | 1089 |
| 43 | Ga0466700_180519 | 3300042600 | Bacteria | 9752 |
| 44 | Ga0466707_244485 | 3300042601 | Bacteria | 7181 |
| 45 | Ga0466713_123747 | 3300042602 | Bacteria | 3319 |
| 46 | Ga0466713_140623 | 3300042602 | Bacteria | 6371 |
| 47 | Ga0466716_499480 | 3300042605 | Bacteria | 1291 |
| 48 | Ga0466719_552617 | 3300042606 | Bacteria | 3577 |
| 49 | Ga0466722_200399 | 3300042609 | Bacteria | 1036 |
| 50 | Ga0466691_110544 | 3300042593 | Bacteria | 3371 |
| 51 | Ga0466694_063222 | 3300042594 | Bacteria | 1862 |
| 52 | Ga0123357_10077885 | 3300009784 | Bacteria | 4370 |
| 53 | Ga0123357_10271600 | 3300009784 | Bacteria | 1771 |
| 54 | Ga0123353_10430625 | 3300010167 | Bacteria | 1951 |
| 55 | Ga0466715_346491 | 3300042616 | Bacteria | 6780 |
| 56 | Ga0466726_127522 | 3300042619 | Bacteria | 1109 |
| 57 | Ga0466726_345544 | 3300042619 | Bacteria | 1104 |
| 58 | Ga0466728_344582 | 3300042620 | Bacteria | 1877 |
| 59 | IMNBL1DRAFT_c0013476 | 3300000062 | Bacteria | 3663 |
| 60 | JGI24702J35022_10003567 | 3300002462 | Bacteria | 9372 |
| 61 | JGI24696J40584_12955891 | 3300002834 | Bacteria | 2957 |
| 62 | Ga0068305_10064185 | 3300005083 | Bacteria | 5436 |
| 63 | Ga0123357_10001078 | 3300009784 | Bacteria | 28159 |
| 64 | Ga0466735_041764 | 3300042624 | Unclassified | 1979 |
| 65 | Ga0466735_053337 | 3300042624 | Bacteria | 2677 |
| 66 | Ga0466735_205290 | 3300042624 | Bacteria | 1189 |
| 67 | Ga0466703_066351 | 3300042636 | Bacteria | 1144 |
| 68 | Ga0466704_106659 | 3300042643 | Bacteria | 5896 |
| 69 | Ga0466704_126989 | 3300042643 | Bacteria | 1182 |
| 70 | Ga0466704_361463 | 3300042643 | Bacteria | 5978 |
| 71 | Ga0466708_103251 | 3300042652 | Bacteria | 2136 |
| 72 | Ga0466727_059638 | 3300042655 | Bacteria | 76336 |
| 73 | Ga0466727_277684 | 3300042655 | Bacteria | 5627 |
| 74 | Ga0466707_163357 | 3300042601 | Unclassified | 2885 |
| 75 | Ga0466707_207642 | 3300042601 | Bacteria | 13770 |
| 76 | Ga0466716_226938 | 3300042605 | Bacteria | 3431 |
| 77 | Ga0466719_049247 | 3300042606 | Bacteria | 4491 |
| 78 | Ga0466719_293170 | 3300042606 | Bacteria | 1096 |
| 79 | Ga0466692_032866 | 3300042591 | Bacteria | 37963 |
| 80 | Ga0466691_046148 | 3300042593 | Bacteria | 2116 |
| 81 | Ga0123357_10031085 | 3300009784 | Bacteria | 7245 |
| 82 | Ga0123354_10276039 | 3300010882 | Bacteria | 1643 |
| 83 | Ga0466711_300073 | 3300042615 | Unclassified | 4271 |
| 84 | Ga0466728_357737 | 3300042620 | Bacteria | 1713 |
| 85 | 2227415819 | 2225789004 | Bacteria | 1053 |
| 86 | JGI24699J35502_11134069 | 3300002509 | Bacteria | 28139 |
| 87 | Ga0072941_1006122 | 3300005201 | Bacteria | 6994 |
| 88 | Ga0466729_283002 | 3300042621 | Bacteria | 1905 |
| 89 | Ga0466735_015871 | 3300042624 | Bacteria | 3363 |
| 90 | Ga0466735_030040 | 3300042624 | Bacteria | 1924 |
| 91 | Ga0466735_134184 | 3300042624 | Bacteria | 1816 |
| 92 | Ga0466735_179576 | 3300042624 | Bacteria | 2616 |
| 93 | Ga0466703_027217 | 3300042636 | Bacteria | 2871 |
| 94 | Ga0466703_039928 | 3300042636 | Bacteria | 12070 |
| 95 | Ga0466703_088889 | 3300042636 | Bacteria | 7130 |
| 96 | Ga0466703_253916 | 3300042636 | Bacteria | 4580 |
| 97 | Ga0466703_311949 | 3300042636 | Unclassified | 6136 |
| 98 | Ga0466703_374426 | 3300042636 | Bacteria | 1053 |
| 99 | Ga0466703_426151 | 3300042636 | Unclassified | 12048 |
| 100 | Ga0466704_003588 | 3300042643 | Bacteria | 4929 |
| 101 | Ga0466704_110256 | 3300042643 | Bacteria | 2442 |
| 102 | Ga0466704_145968 | 3300042643 | Bacteria | 20472 |
| 103 | Ga0466709_179680 | 3300042648 | Bacteria | 3965 |
| 104 | Ga0466708_049715 | 3300042652 | Bacteria | 8955 |
| 105 | Ga0466708_203233 | 3300042652 | Bacteria | 4807 |
| 106 | Ga0466727_231234 | 3300042655 | Unclassified | 3749 |
| 107 | Ga0466701_099440 | 3300042598 | Bacteria | 19482 |
| 108 | Ga0466707_005829 | 3300042601 | Bacteria | 11734 |
| 109 | Ga0466707_096027 | 3300042601 | Bacteria | 11426 |
| 110 | Ga0466713_026078 | 3300042602 | Bacteria | 10505 |
| 111 | Ga0466713_063710 | 3300042602 | Bacteria | 2080 |
| 112 | Ga0466719_060461 | 3300042606 | Unclassified | 2275 |
| 113 | Ga0466719_275496 | 3300042606 | Bacteria | 1488 |
| 114 | Ga0466705_303741 | 3300042612 | Bacteria | 6356 |
| 115 | Ga0466690_049979 | 3300042590 | Bacteria | 10530 |
| 116 | Ga0466690_233517 | 3300042590 | Bacteria | 1261 |
| 117 | Ga0466690_428962 | 3300042590 | Bacteria | 12538 |
| 118 | Ga0123357_10638516 | 3300009784 | Bacteria | 795 |
| 119 | Ga0123354_10002114 | 3300010882 | Bacteria | 25692 |
| 120 | Ga0123354_10100115 | 3300010882 | Bacteria | 3926 |
| 121 | Ga0466711_160586 | 3300042615 | Bacteria | 4165 |
| 122 | Ga0466711_169277 | 3300042615 | Bacteria | 4162 |
| 123 | Ga0466711_246639 | 3300042615 | Bacteria | 53228 |
| 124 | Ga0466711_250554 | 3300042615 | Bacteria | 1324 |
| 125 | Ga0466711_276881 | 3300042615 | Bacteria | 1906 |
| 126 | Ga0466715_019282 | 3300042616 | Bacteria | 3153 |
| 127 | Ga0466715_199813 | 3300042616 | Bacteria | 9480 |
| 128 | Ga0466715_397219 | 3300042616 | Bacteria | 15214 |
| 129 | Ga0466723_127627 | 3300042618 | Bacteria | 23549 |
| 130 | Ga0466726_134074 | 3300042619 | Bacteria | 4573 |
| 131 | Ga0466728_146541 | 3300042620 | Bacteria | 17016 |
| 132 | Ga0466728_423300 | 3300042620 | Bacteria | 2660 |
| 133 | Ga0068302_10155611 | 3300005071 | Bacteria | 542 |
| 134 | Ga0072940_1091247 | 3300005200 | Bacteria | 703 |
| 135 | Ga0466735_039161 | 3300042624 | Bacteria | 4265 |
| 136 | Ga0466735_121066 | 3300042624 | Bacteria | 1512 |
| 137 | Ga0466735_157441 | 3300042624 | Bacteria | 3867 |
| 138 | Ga0466703_006811 | 3300042636 | Bacteria | 2260 |
| 139 | Ga0466703_261718 | 3300042636 | Bacteria | 5007 |
| 140 | Ga0466703_409899 | 3300042636 | Bacteria | 4032 |
| 141 | Ga0466704_004444 | 3300042643 | Bacteria | 24992 |
| 142 | Ga0466704_029792 | 3300042643 | Bacteria | 5389 |
| 143 | Ga0466704_119962 | 3300042643 | Bacteria | 4059 |
| 144 | Ga0466709_255832 | 3300042648 | Unclassified | 1776 |
| 145 | Ga0466708_047981 | 3300042652 | Bacteria | 5349 |
| 146 | Ga0466708_058784 | 3300042652 | Bacteria | 22537 |
| 147 | Ga0466708_082792 | 3300042652 | Bacteria | 10305 |
| 148 | Ga0466727_005596 | 3300042655 | Bacteria | 29432 |
| 149 | Ga0466727_108394 | 3300042655 | Unclassified | 1220 |
| 150 | Ga0466727_170739 | 3300042655 | Bacteria | 1061 |
| 151 | Ga0466707_255141 | 3300042601 | Bacteria | 1949 |
| 152 | Ga0466707_280686 | 3300042601 | Bacteria | 2096 |
| 153 | Ga0466713_017186 | 3300042602 | Bacteria | 16604 |
| 154 | Ga0466722_075447 | 3300042609 | Bacteria | 7189 |
| 155 | Ga0466698_114571 | 3300042610 | Bacteria | 1142 |
| 156 | Ga0466705_027016 | 3300042612 | Bacteria | 3365 |
| 157 | Ga0466705_361494 | 3300042612 | Bacteria | 5544 |
| 158 | Ga0466692_046839 | 3300042591 | Bacteria | 12461 |
| 159 | Ga0466696_152436 | 3300042596 | Bacteria | 8226 |
| 160 | Ga0466696_433301 | 3300042596 | Bacteria | 2136 |
| 161 | Ga0123357_10082093 | 3300009784 | Bacteria | 4234 |
| 162 | Ga0466723_085066 | 3300042618 | Bacteria | 10621 |
| 163 | Ga0466728_089093 | 3300042620 | Bacteria | 3836 |
| 164 | Ga0466728_450763 | 3300042620 | Bacteria | 7249 |
| 165 | JGI24705J35276_12228666 | 3300002504 | Bacteria | 3232 |
| 166 | JGI24699J35502_11133694 | 3300002509 | Bacteria | 13722 |
| 167 | Ga0068302_10066838 | 3300005071 | Bacteria | 918 |
| 168 | Ga0068302_10111353 | 3300005071 | Bacteria | 5220 |
| 169 | Ga0072941_1029158 | 3300005201 | Bacteria | 3288 |
| 170 | Ga0466735_008587 | 3300042624 | Unclassified | 1112 |
| 171 | Ga0466735_071393 | 3300042624 | Unclassified | 1725 |
| 172 | Ga0466703_007464 | 3300042636 | Bacteria | 2422 |
| 173 | Ga0466703_204105 | 3300042636 | Bacteria | 1123 |
| 174 | Ga0466703_272779 | 3300042636 | Bacteria | 16723 |
| 175 | Ga0466704_266092 | 3300042643 | Bacteria | 17282 |
| 176 | Ga0466708_324759 | 3300042652 | Bacteria | 1393 |
| 177 | Ga0466727_012165 | 3300042655 | Bacteria | 12981 |
| 178 | Ga0466727_216908 | 3300042655 | Bacteria | 1194 |
| 179 | Ga0466701_075211 | 3300042598 | Bacteria | 18506 |
| 180 | Ga0466719_419689 | 3300042606 | Bacteria | 6279 |
| 181 | Ga0466719_489215 | 3300042606 | Unclassified | 1339 |
| 182 | Ga0466722_222443 | 3300042609 | Bacteria | 2850 |
| 183 | Ga0466697_203120 | 3300042611 | Bacteria | 1514 |
| 184 | Ga0466690_180553 | 3300042590 | Bacteria | 6438 |
| 185 | Ga0466691_096505 | 3300042593 | Bacteria | 32436 |
| 186 | Ga0466696_153409 | 3300042596 | Bacteria | 2851 |
| 187 | Ga0466696_345572 | 3300042596 | Bacteria | 8331 |
| 188 | Ga0123357_10019419 | 3300009784 | Bacteria | 9057 |
| 189 | Ga0123357_10263388 | 3300009784 | Bacteria | 1817 |
| 190 | Ga0123354_10055882 | 3300010882 | Bacteria | 5901 |
| 191 | Ga0466726_111841 | 3300042619 | Unclassified | 1284 |
| 192 | Ga0466726_197875 | 3300042619 | Bacteria | 1247 |
| 193 | Ga0466726_382421 | 3300042619 | Bacteria | 1605 |
| 194 | Ga0466728_153795 | 3300042620 | Bacteria | 1676 |
| 195 | JGI24702J35022_10004127 | 3300002462 | Bacteria | 8681 |
| 196 | JGI24702J35022_10027398 | 3300002462 | Bacteria | 3066 |
| 197 | JGI24705J35276_12234001 | 3300002504 | Bacteria | 5188 |
| 198 | Ga0123357_10000491 | 3300009784 | Bacteria | 38307 |
| 199 | Ga0466735_087802 | 3300042624 | Bacteria | 2127 |
| 200 | Ga0466703_062102 | 3300042636 | Viruses | 7582 |
| 201 | Ga0466703_160954 | 3300042636 | Unclassified | 6361 |
| 202 | Ga0466727_100165 | 3300042655 | Bacteria | 1942 |
| 203 | Ga0466701_061905 | 3300042598 | Bacteria | 1372 |
| 204 | Ga0466701_099279 | 3300042598 | Bacteria | 1621 |
| 205 | Ga0466706_036146 | 3300042599 | Bacteria | 7657 |
| 206 | Ga0466700_441738 | 3300042600 | Bacteria | 12466 |
| 207 | Ga0466707_185312 | 3300042601 | Bacteria | 99373 |
| 208 | Ga0466707_270832 | 3300042601 | Bacteria | 16847 |
| 209 | Ga0466713_035234 | 3300042602 | Bacteria | 43574 |
| 210 | Ga0466722_110430 | 3300042609 | Bacteria | 16688 |
| 211 | Ga0466722_132461 | 3300042609 | Bacteria | 1975 |
| 212 | Ga0466705_178726 | 3300042612 | Bacteria | 2614 |
| 213 | Ga0466690_094063 | 3300042590 | Bacteria | 25360 |
| 214 | Ga0466692_188071 | 3300042591 | Bacteria | 6102 |
| 215 | Ga0123356_11306872 | 3300010049 | Bacteria | 888 |
| 216 | Ga0466710_082510 | 3300042613 | Bacteria | 2176 |
| 217 | Ga0466711_283470 | 3300042615 | Unclassified | 1885 |
| 218 | Ga0466715_091851 | 3300042616 | Bacteria | 23031 |
| 219 | Ga0466723_118727 | 3300042618 | Viruses | 3348 |
| 220 | JGI24705J35276_12200668 | 3300002504 | Bacteria | 1606 |
| 221 | JGI24705J35276_12232021 | 3300002504 | Bacteria | 4154 |
| 222 | Ga0068305_10071178 | 3300005083 | Bacteria | 977 |
| 223 | Ga0466735_003211 | 3300042624 | Bacteria | 1194 |
| 224 | Ga0466735_230407 | 3300042624 | Bacteria | 2222 |
| 225 | Ga0466727_003520 | 3300042655 | Bacteria | 3906 |
| 226 | Ga0466727_191351 | 3300042655 | Bacteria | 1619 |
| 227 | Ga0466727_273200 | 3300042655 | Unclassified | 1169 |
| 228 | Ga0466700_257109 | 3300042600 | Bacteria | 5804 |
| 229 | Ga0466707_126179 | 3300042601 | Bacteria | 55735 |
| 230 | Ga0466707_287105 | 3300042601 | Bacteria | 20316 |
| 231 | Ga0466722_034887 | 3300042609 | Bacteria | 3824 |
| 232 | Ga0466722_136634 | 3300042609 | Bacteria | 6619 |
| 233 | Ga0466722_205060 | 3300042609 | Bacteria | 8320 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02357 | NusG | Transcription termination factor nusG | 27 | 122 | 0.79 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.