Protein Family IF00752
Metagenome
111
Members
43
Samples
110
Scaffolds
422.09
Avg Length
Representative Sequence
- ID
- 3300002462|JGI24702J35022_10001541|JGI24702J35022_100015416
- Length
- 479 aa
- Sequence
- MFKIFRKNCCGLDVHKTWIYACVGITDARGLTEYKQARFSSFSKGLRDLATWLEKHGCKEVCMESASKYWIPVFNILEKTCWVTLAHPKYTKPQKGNKTDRKDAKWICDLFMCNMIKPSFIPPLDIRELRDLLRYRFKLTNCLVGEKNRAQNCLTVSNLKLDDVFTDVFGKSASSITGYILDHPGEQFDVTPFVDWRCRTPIEEIQAAVDGSISREQAAKLRECLKHIELRLAEPYAFALELIRTVPGFSANPMTAIAVISEIGVDMSVFPTAKHLSSWAGCCPRNDQSGGKRKSTRISRAGTYLKPLLVQVANAVVKSDKYPEYKERYRRLKARRGHKKAIIAICRMFLTAIWNILSKLEPYAPKGFLADPLPDKVKTLTKAQALNLLRSRGYVIQDDTPSLSARVTLSLFFGCLQAAGFVMPFFRVSGFWLVSSLPSPYIRNSKPLLLILILIRNRFSVKALQHSLPRLRRIVLQP*
Sample Types
Isolate
0.0%
Metagenome
100.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
61.9%
Kalotermitidae
23.8%
Rhinotermitidae
4.8%
Hodotermitidae
2.4%
Termopsidae
2.4%
Tenebrionidae
2.4%
Unclassified
2.4%
Taxonomy
Archaea
0
Bacteria
101
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 5 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 6 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 9 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 10 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 11 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 12 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 13 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 14 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 15 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 16 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 17 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 18 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 19 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 20 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 21 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 22 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 23 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 24 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 25 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 26 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 27 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 28 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 29 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 30 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 31 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 32 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 33 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 34 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 35 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 36 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 37 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 38 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 39 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 40 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 41 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 42 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 43 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466734_102412 | 3300042623 | Bacteria | 3369 |
| 2 | Ga0466703_271275 | 3300042636 | Bacteria | 1787 |
| 3 | Ga0466709_255095 | 3300042648 | Bacteria | 2027 |
| 4 | Ga0123357_10153995 | 3300009784 | Bacteria | 2779 |
| 5 | Ga0123356_10094967 | 3300010049 | Bacteria | 2849 |
| 6 | Ga0123356_10191089 | 3300010049 | Bacteria | 2079 |
| 7 | Ga0123356_10202193 | 3300010049 | Bacteria | 2027 |
| 8 | Ga0123356_10275159 | 3300010049 | Bacteria | 1775 |
| 9 | Ga0123353_10424841 | 3300010167 | Bacteria | 1968 |
| 10 | Ga0123353_10477252 | 3300010167 | Bacteria | 1826 |
| 11 | Ga0415639_018093 | 3300038395 | Bacteria | 3728 |
| 12 | JGI24702J35022_10006273 | 3300002462 | Unclassified | 6879 |
| 13 | Ga0466701_065896 | 3300042598 | Bacteria | 1867 |
| 14 | Ga0466700_416749 | 3300042600 | Bacteria | 1903 |
| 15 | Ga0466714_128531 | 3300042603 | Bacteria | 3498 |
| 16 | Ga0466720_038968 | 3300042607 | Bacteria | 1843 |
| 17 | Ga0466733_208672 | 3300042659 | Bacteria | 2051 |
| 18 | Ga0562377_0569 | 3300056842 | Unclassified | 56726 |
| 19 | Ga0466710_210849 | 3300042613 | Bacteria | 2992 |
| 20 | Ga0466710_372925 | 3300042613 | Bacteria | 1821 |
| 21 | Ga0466718_046348 | 3300042617 | Bacteria | 2276 |
| 22 | Ga0466718_064980 | 3300042617 | Unclassified | 2050 |
| 23 | Ga0466731_372529 | 3300042622 | Unclassified | 2127 |
| 24 | Ga0466734_072795 | 3300042623 | Bacteria | 1957 |
| 25 | Ga0466703_420567 | 3300042636 | Unclassified | 1564 |
| 26 | Ga0466709_191668 | 3300042648 | Bacteria | 3118 |
| 27 | Ga0123354_10059965 | 3300010882 | Bacteria | 5637 |
| 28 | Ga0466691_070781 | 3300042593 | Bacteria | 10782 |
| 29 | Ga0466694_171359 | 3300042594 | Bacteria | 3165 |
| 30 | Ga0466695_193944 | 3300042595 | Bacteria | 2086 |
| 31 | Ga0466706_046339 | 3300042599 | Bacteria | 3068 |
| 32 | Ga0466700_437353 | 3300042600 | Bacteria | 1732 |
| 33 | Ga0466713_119231 | 3300042602 | Bacteria | 1621 |
| 34 | Ga0466716_451969 | 3300042605 | Bacteria | 2625 |
| 35 | Ga0466710_065719 | 3300042613 | Bacteria | 2061 |
| 36 | Ga0466711_134246 | 3300042615 | Bacteria | 2096 |
| 37 | Ga0466715_030803 | 3300042616 | Bacteria | 5254 |
| 38 | Ga0466725_050706 | 3300042654 | Bacteria | 2743 |
| 39 | Ga0123355_10334528 | 3300009826 | Bacteria | 2024 |
| 40 | Ga0123355_10343007 | 3300009826 | Bacteria | 1988 |
| 41 | Ga0123355_10374838 | 3300009826 | Bacteria | 1860 |
| 42 | Ga0123356_10137178 | 3300010049 | Bacteria | 2407 |
| 43 | Ga0123353_10162897 | 3300010167 | Bacteria | 3549 |
| 44 | Ga0123353_10406723 | 3300010167 | Bacteria | 2023 |
| 45 | Ga0123353_10510309 | 3300010167 | Bacteria | 1748 |
| 46 | Ga0415639_062019 | 3300038395 | Bacteria | 2299 |
| 47 | Ga0466694_046008 | 3300042594 | Bacteria | 1933 |
| 48 | Ga0466696_121421 | 3300042596 | Bacteria | 2337 |
| 49 | JGI24696J40584_12940509 | 3300002834 | Bacteria | 1680 |
| 50 | Ga0466706_235896 | 3300042599 | Bacteria | 1604 |
| 51 | Ga0466700_057011 | 3300042600 | Bacteria | 2426 |
| 52 | Ga0466700_180151 | 3300042600 | Bacteria | 3120 |
| 53 | Ga0466700_450664 | 3300042600 | Bacteria | 1764 |
| 54 | Ga0466733_042625 | 3300042659 | Bacteria | 12344 |
| 55 | Ga0562377_0011 | 3300056842 | Bacteria | 1259346 |
| 56 | Ga0466705_417074 | 3300042612 | Bacteria | 1780 |
| 57 | Ga0466711_264340 | 3300042615 | Bacteria | 3193 |
| 58 | Ga0466731_056193 | 3300042622 | Bacteria | 1681 |
| 59 | Ga0466734_046164 | 3300042623 | Bacteria | 2449 |
| 60 | Ga0466709_161935 | 3300042648 | Bacteria | 1687 |
| 61 | Ga0123356_10408841 | 3300010049 | Bacteria | 1496 |
| 62 | Ga0123353_10258058 | 3300010167 | Bacteria | 2695 |
| 63 | Ga0123353_10367095 | 3300010167 | Bacteria | 2160 |
| 64 | Ga0123353_10589247 | 3300010167 | Bacteria | 1593 |
| 65 | Ga0466693_194641 | 3300042592 | Bacteria | 2020 |
| 66 | Ga0466699_281283 | 3300042597 | Unclassified | 3010 |
| 67 | Ga0466714_117794 | 3300042603 | Bacteria | 2566 |
| 68 | Ga0466717_086839 | 3300042604 | Bacteria | 2284 |
| 69 | Ga0466697_236492 | 3300042611 | Bacteria | 2656 |
| 70 | Ga0466711_299680 | 3300042615 | Bacteria | 1911 |
| 71 | Ga0466735_040280 | 3300042624 | Bacteria | 1423 |
| 72 | Ga0466704_234548 | 3300042643 | Unclassified | 1444 |
| 73 | Ga0123357_10057383 | 3300009784 | Bacteria | 5232 |
| 74 | Ga0123353_10151198 | 3300010167 | Bacteria | 3706 |
| 75 | Ga0123353_10448367 | 3300010167 | Bacteria | 1901 |
| 76 | Ga0123353_10450586 | 3300010167 | Bacteria | 1895 |
| 77 | Ga0466700_190038 | 3300042600 | Bacteria | 2291 |
| 78 | Ga0466719_218951 | 3300042606 | Bacteria | 2159 |
| 79 | Ga0466710_191516 | 3300042613 | Bacteria | 3098 |
| 80 | Ga0466704_331685 | 3300042643 | Bacteria | 2557 |
| 81 | Ga0123353_10293615 | 3300010167 | Bacteria | 2487 |
| 82 | Ga0123353_10390701 | 3300010167 | Bacteria | 2076 |
| 83 | Ga0466691_120886 | 3300042593 | Bacteria | 2228 |
| 84 | Ga0072941_1233234 | 3300005201 | Bacteria | 1592 |
| 85 | Ga0466719_017643 | 3300042606 | Bacteria | 3491 |
| 86 | Ga0466722_256324 | 3300042609 | Bacteria | 1852 |
| 87 | Ga0466698_078216 | 3300042610 | Bacteria | 4695 |
| 88 | Ga0466705_226055 | 3300042612 | Bacteria | 32392 |
| 89 | Ga0466710_026381 | 3300042613 | Bacteria | 1904 |
| 90 | Ga0466715_237448 | 3300042616 | Bacteria | 49401 |
| 91 | Ga0466703_249033 | 3300042636 | Bacteria | 1446 |
| 92 | Ga0466704_196384 | 3300042643 | Bacteria | 2305 |
| 93 | Ga0123356_10234703 | 3300010049 | Bacteria | 1901 |
| 94 | Ga0123356_10408442 | 3300010049 | Bacteria | 1497 |
| 95 | Ga0123353_10295316 | 3300010167 | Bacteria | 2478 |
| 96 | Ga0123353_10466474 | 3300010167 | Bacteria | 1853 |
| 97 | Ga0415639_061951 | 3300038395 | Bacteria | 5791 |
| 98 | Ga0466714_030767 | 3300042603 | Unclassified | 2363 |
| 99 | Ga0466705_086856 | 3300042612 | Unclassified | 2613 |
| 100 | Ga0466709_079357 | 3300042648 | Bacteria | 22688 |
| 101 | Ga0466724_08355 | 3300042649 | Bacteria | 1965 |
| 102 | Ga0123356_10121404 | 3300010049 | Bacteria | 2542 |
| 103 | Ga0123353_10133256 | 3300010167 | Bacteria | 3986 |
| 104 | Ga0123353_10373010 | 3300010167 | Bacteria | 2138 |
| 105 | Ga0415639_146297 | 3300038395 | Unclassified | 1506 |
| 106 | Ga0466692_055986 | 3300042591 | Bacteria | 2035 |
| 107 | Ga0466696_266414 | 3300042596 | Bacteria | 1938 |
| 108 | JGI24702J35022_10001541 | 3300002462 | Bacteria | 14299 |
| 109 | Ga0466701_081802 | 3300042598 | Bacteria | 2062 |
| 110 | Ga0466713_092269 | 3300042602 | Bacteria | 9487 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.