Protein Family IF00747
Metagenome
Isolate
208
Members
68
Samples
180
Scaffolds
297.02
Avg Length
Representative Sequence
- ID
- 3300002462|JGI24702J35022_10000943|JGI24702J35022_1000094313
- Length
- 337 aa
- Sequence
- LTRREKTLENSLTESRIRNVDAFAGFHPVINLLYFVAVIGFAMLFTHPVCLGISLLCAIIYSIYLRGKKAARFNLIYLLPMLVFAALLNPVFNHQGSTILAYLPDGNPLTLESVLYGISAGVMLITVISWFSCFNVIMTSDKFVYLFGKITPALSLILSMALRIVPRFKAQIKVISNAQKCVGRDISNGNLLLKIRHGIRILSIMVTWALESAIETADSMKGRGYGLPGRSAFSIFRFDRRDGYALIYIMLCSAAALTGNFTGTYHFRYFPTIKGKWTGATLIIFAAYLALCAFPIIASIIEDFVWKYASPSFSGSASFSFTGSSHKDGTNNGYDL*
Sample Types
Isolate
13.5%
Metagenome
86.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
38.2%
Termitidae
33.8%
Kalotermitidae
16.2%
Rhinotermitidae
5.9%
Passalidae
2.9%
Termopsidae
2.9%
Taxonomy
Archaea
2
Bacteria
190
Eukaryota
0
Viruses
0
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820220859 | Unclassified Firmicutes Th196P4bin59 | Isolate | Unclassified |
| 2 | 2820252425 | Unclassified Firmicutes Th196P3bin6 | Isolate | Unclassified |
| 3 | 2820342392 | Unclassified Firmicutes Nt197P3bin64 | Isolate | Unclassified |
| 4 | 2820371985 | Unclassified Firmicutes Nt197P3bin100 | Isolate | Unclassified |
| 5 | 2820499546 | Unclassified Firmicutes Lab288P1bin54 | Isolate | Unclassified |
| 6 | 2820702360 | Unclassified Firmicutes Co191P1bin4 | Isolate | Unclassified |
| 7 | 2820044805 | Unclassified Proteobacteria Th196P4bin15 | Isolate | Unclassified |
| 8 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 9 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 10 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 11 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 12 | 2820431532 | Unclassified Firmicutes Lab288P3bin230 | Isolate | Unclassified |
| 13 | 2820593525 | Unclassified Firmicutes Emb289P1bin7 | Isolate | Unclassified |
| 14 | 2820707375 | Unclassified Firmicutes Co191P1bin31 | Isolate | Unclassified |
| 15 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 16 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 17 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 18 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 19 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 20 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 21 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 22 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 23 | 2585428141 | Pilibacter termitis ATCC BAA-1030 | Isolate | Rhinotermitidae |
| 24 | 2820314258 | Unclassified Firmicutes Nt197P4bin16 | Isolate | Unclassified |
| 25 | 2820340373 | Unclassified Firmicutes Nt197P3bin67 | Isolate | Unclassified |
| 26 | 2820528380 | Unclassified Firmicutes Lab288P1bin143 | Isolate | Unclassified |
| 27 | 2820693137 | Unclassified Firmicutes Co191P1bin70 | Isolate | Unclassified |
| 28 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 29 | 2820525019 | Unclassified Firmicutes Lab288P1bin2 | Isolate | Unclassified |
| 30 | 2820619171 | Unclassified Firmicutes Emb289P1bin130 | Isolate | Unclassified |
| 31 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 32 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 33 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 34 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 35 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 36 | 2820238527 | Unclassified Firmicutes Th196P3bin90 | Isolate | Unclassified |
| 37 | 2820683647 | Unclassified Firmicutes Co191P1bin82 | Isolate | Unclassified |
| 38 | 2772191001 | Unclassified Bathyarchaeota Th196P4bin19 | Isolate | Unclassified |
| 39 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 40 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 41 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 42 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 43 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 44 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 45 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 46 | 2820324456 | Unclassified Firmicutes Nt197P3bin80 | Isolate | Unclassified |
| 47 | 2820504582 | Unclassified Firmicutes Lab288P1bin5 | Isolate | Unclassified |
| 48 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 49 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 50 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 51 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 52 | 2585428085 | Sporobacter termitidis DSM 10068 | Isolate | Termitidae |
| 53 | 2820227065 | Unclassified Firmicutes Th196P4bin44 | Isolate | Unclassified |
| 54 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 55 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 56 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 57 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 58 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 59 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 60 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 61 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 62 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 63 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 64 | 2820323050 | Unclassified Firmicutes Nt197P3bin84 | Isolate | Unclassified |
| 65 | 2820347164 | Unclassified Firmicutes Nt197P3bin58 | Isolate | Unclassified |
| 66 | 2820356982 | Unclassified Firmicutes Nt197P3bin19 | Isolate | Unclassified |
| 67 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 68 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466704_173441 | 3300042643 | Bacteria | 24498 |
| 2 | Ga0123355_10000699 | 3300009826 | Bacteria | 45528 |
| 3 | Ga0123355_10006755 | 3300009826 | Bacteria | 17074 |
| 4 | Ga0123355_10017261 | 3300009826 | Bacteria | 11401 |
| 5 | Ga0123356_10245381 | 3300010049 | Bacteria | 1865 |
| 6 | Ga0123356_10341136 | 3300010049 | Unclassified | 1618 |
| 7 | Ga0123353_10024591 | 3300010167 | Bacteria | 9148 |
| 8 | Ga0123353_10146303 | 3300010167 | Bacteria | 3778 |
| 9 | Ga0123353_10291668 | 3300010167 | Bacteria | 2497 |
| 10 | Ga0123353_10304139 | 3300010167 | Unclassified | 2432 |
| 11 | Ga0123353_10505719 | 3300010167 | Bacteria | 1759 |
| 12 | Ga0123354_10001196 | 3300010882 | Bacteria | 30578 |
| 13 | Ga0466705_427773 | 3300042612 | Bacteria | 83042 |
| 14 | Ga0466718_051838 | 3300042617 | Bacteria | 5405 |
| 15 | Ga0466726_045407 | 3300042619 | Bacteria | 1057 |
| 16 | Ga0466726_142061 | 3300042619 | Bacteria | 20798 |
| 17 | Ga0466726_288673 | 3300042619 | Bacteria | 6829 |
| 18 | JGI24702J35022_10000943 | 3300002462 | Bacteria | 18167 |
| 19 | JGI24702J35022_10001568 | 3300002462 | Bacteria | 14183 |
| 20 | JGI24702J35022_10008662 | 3300002462 | Bacteria | 5748 |
| 21 | JGI24702J35022_10023189 | 3300002462 | Bacteria | 3355 |
| 22 | Ga0415639_037103 | 3300038395 | Bacteria | 11811 |
| 23 | Ga0466692_199734 | 3300042591 | Bacteria | 9044 |
| 24 | Ga0466693_155617 | 3300042592 | Bacteria | 1732 |
| 25 | Ga0466707_262896 | 3300042601 | Bacteria | 2501 |
| 26 | Ga0466719_301663 | 3300042606 | Bacteria | 2915 |
| 27 | Ga0466722_094207 | 3300042609 | Bacteria | 3689 |
| 28 | Ga0466697_270122 | 3300042611 | Unclassified | 4232 |
| 29 | Ga0466697_270208 | 3300042611 | Bacteria | 1784 |
| 30 | Ga0466734_012362 | 3300042623 | Bacteria | 2420 |
| 31 | Ga0123357_10234405 | 3300009784 | Bacteria | 2003 |
| 32 | Ga0123355_10006422 | 3300009826 | Bacteria | 17415 |
| 33 | Ga0123353_10001293 | 3300010167 | Bacteria | 30715 |
| 34 | Ga0123353_10009774 | 3300010167 | Bacteria | 13289 |
| 35 | Ga0123353_10032073 | 3300010167 | Bacteria | 8153 |
| 36 | Ga0123353_10047307 | 3300010167 | Bacteria | 6841 |
| 37 | Ga0123353_10234007 | 3300010167 | Bacteria | 2861 |
| 38 | Ga0123353_10286842 | 3300010167 | Bacteria | 2523 |
| 39 | Ga0123353_10295134 | 3300010167 | Bacteria | 2479 |
| 40 | Ga0123353_10702231 | 3300010167 | Bacteria | 1419 |
| 41 | Ga0466711_030328 | 3300042615 | Bacteria | 4314 |
| 42 | Ga0466728_388646 | 3300042620 | Bacteria | 1969 |
| 43 | JGI24695J34938_10061962 | 3300002450 | Bacteria | 1591 |
| 44 | JGI24702J35022_10012079 | 3300002462 | Bacteria | 4806 |
| 45 | JGI24702J35022_10012094 | 3300002462 | Bacteria | 4803 |
| 46 | JGI24705J35276_12234320 | 3300002504 | Bacteria | 5424 |
| 47 | Ga0415639_093108 | 3300038395 | Bacteria | 4626 |
| 48 | Ga0466692_150809 | 3300042591 | Bacteria | 85319 |
| 49 | Ga0466700_242723 | 3300042600 | Unclassified | 2133 |
| 50 | Ga0466707_118135 | 3300042601 | Bacteria | 3311 |
| 51 | Ga0466717_294947 | 3300042604 | Bacteria | 1371 |
| 52 | Ga0466716_073923 | 3300042605 | Bacteria | 5906 |
| 53 | Ga0466731_003910 | 3300042622 | Bacteria | 3388 |
| 54 | Ga0466703_023750 | 3300042636 | Bacteria | 34022 |
| 55 | Ga0466703_310129 | 3300042636 | Bacteria | 4536 |
| 56 | Ga0466725_357844 | 3300042654 | Unclassified | 1558 |
| 57 | Ga0123355_10007518 | 3300009826 | Bacteria | 16345 |
| 58 | Ga0123356_10060619 | 3300010049 | Bacteria | 3531 |
| 59 | Ga0123356_10218705 | 3300010049 | Bacteria | 1960 |
| 60 | Ga0123353_10006346 | 3300010167 | Bacteria | 15729 |
| 61 | Ga0123353_10043736 | 3300010167 | Bacteria | 7097 |
| 62 | Ga0123353_10181352 | 3300010167 | Bacteria | 3333 |
| 63 | Ga0123353_10363271 | 3300010167 | Bacteria | 2174 |
| 64 | Ga0123354_10113256 | 3300010882 | Bacteria | 3565 |
| 65 | Ga0466715_323461 | 3300042616 | Bacteria | 7147 |
| 66 | Ga0466726_280697 | 3300042619 | Bacteria | 11220 |
| 67 | Ga0466726_307293 | 3300042619 | Bacteria | 1815 |
| 68 | Ga0466726_451022 | 3300042619 | Bacteria | 12723 |
| 69 | JGI24702J35022_10096717 | 3300002462 | Bacteria | 1612 |
| 70 | JGI24705J35276_12236229 | 3300002504 | Bacteria | 7682 |
| 71 | Ga0415639_023002 | 3300038395 | Bacteria | 2315 |
| 72 | Ga0466696_105368 | 3300042596 | Bacteria | 2964 |
| 73 | Ga0466696_319445 | 3300042596 | Bacteria | 8530 |
| 74 | Ga0466707_339136 | 3300042601 | Unclassified | 1763 |
| 75 | Ga0466717_240876 | 3300042604 | Bacteria | 4686 |
| 76 | Ga0466719_328398 | 3300042606 | Bacteria | 7235 |
| 77 | Ga0466734_027248 | 3300042623 | Bacteria | 1410 |
| 78 | Ga0466704_236580 | 3300042643 | Bacteria | 1170 |
| 79 | Ga0123355_10011020 | 3300009826 | Bacteria | 13914 |
| 80 | Ga0123355_10022992 | 3300009826 | Bacteria | 10001 |
| 81 | Ga0123355_10070825 | 3300009826 | Bacteria | 5599 |
| 82 | Ga0123355_10158106 | 3300009826 | Bacteria | 3423 |
| 83 | Ga0123355_10258927 | 3300009826 | Bacteria | 2436 |
| 84 | Ga0123356_10115199 | 3300010049 | Bacteria | 2604 |
| 85 | Ga0123353_10000130 | 3300010167 | Bacteria | 91214 |
| 86 | Ga0123353_10000349 | 3300010167 | Bacteria | 56546 |
| 87 | Ga0466705_471696 | 3300042612 | Bacteria | 2466 |
| 88 | Ga0466715_102876 | 3300042616 | Bacteria | 2830 |
| 89 | Ga0466715_280451 | 3300042616 | Bacteria | 11870 |
| 90 | Ga0466718_090949 | 3300042617 | Bacteria | 1440 |
| 91 | Ga0466726_362553 | 3300042619 | Bacteria | 2542 |
| 92 | 2227375245 | 2225789004 | Bacteria | 5979 |
| 93 | Ga0415639_007632 | 3300038395 | Bacteria | 40242 |
| 94 | Ga0466694_162582 | 3300042594 | Bacteria | 1975 |
| 95 | Ga0466700_010536 | 3300042600 | Bacteria | 1661 |
| 96 | Ga0466707_332195 | 3300042601 | Bacteria | 2881 |
| 97 | Ga0466717_190344 | 3300042604 | Bacteria | 3720 |
| 98 | Ga0466705_202484 | 3300042612 | Bacteria | 6972 |
| 99 | Ga0466705_342375 | 3300042612 | Bacteria | 20094 |
| 100 | Ga0466703_373555 | 3300042636 | Bacteria | 15376 |
| 101 | Ga0123355_10002132 | 3300009826 | Bacteria | 27941 |
| 102 | Ga0123356_10360422 | 3300010049 | Bacteria | 1581 |
| 103 | Ga0123356_10935664 | 3300010049 | Bacteria | 1038 |
| 104 | Ga0123353_10011726 | 3300010167 | Bacteria | 12377 |
| 105 | Ga0123353_10133100 | 3300010167 | Bacteria | 3989 |
| 106 | Ga0123353_10458177 | 3300010167 | Bacteria | 1875 |
| 107 | Ga0123353_10530452 | 3300010167 | Bacteria | 1705 |
| 108 | Ga0466715_187191 | 3300042616 | Bacteria | 35306 |
| 109 | Ga0466729_037404 | 3300042621 | Bacteria | 7681 |
| 110 | IMNBL1DRAFT_c0000092 | 3300000062 | Bacteria | 78613 |
| 111 | JGI24702J35022_10078404 | 3300002462 | Bacteria | 1788 |
| 112 | JGI24705J35276_12207798 | 3300002504 | Bacteria | 1756 |
| 113 | Ga0415639_022847 | 3300038395 | Bacteria | 3126 |
| 114 | Ga0415639_160559 | 3300038395 | Unclassified | 2049 |
| 115 | Ga0466707_211143 | 3300042601 | Bacteria | 2483 |
| 116 | Ga0466705_159325 | 3300042612 | Bacteria | 13538 |
| 117 | Ga0466704_443155 | 3300042643 | Bacteria | 1244 |
| 118 | Ga0466704_504124 | 3300042643 | Bacteria | 5059 |
| 119 | Ga0466708_185794 | 3300042652 | Bacteria | 28361 |
| 120 | Ga0466727_063419 | 3300042655 | Bacteria | 4701 |
| 121 | Ga0466727_066879 | 3300042655 | Bacteria | 2159 |
| 122 | Ga0123355_10003486 | 3300009826 | Bacteria | 22560 |
| 123 | Ga0123355_10052018 | 3300009826 | Unclassified | 6647 |
| 124 | Ga0123355_10189422 | 3300009826 | Bacteria | 3034 |
| 125 | Ga0123355_10257864 | 3300009826 | Bacteria | 2443 |
| 126 | Ga0123355_10567944 | 3300009826 | Bacteria | 1363 |
| 127 | Ga0123356_10164676 | 3300010049 | Bacteria | 2220 |
| 128 | Ga0123356_10181213 | 3300010049 | Unclassified | 2128 |
| 129 | Ga0123356_10310583 | 3300010049 | Bacteria | 1685 |
| 130 | Ga0123353_10190537 | 3300010167 | Unclassified | 3238 |
| 131 | Ga0466705_406162 | 3300042612 | Bacteria | 10415 |
| 132 | Ga0466705_454477 | 3300042612 | Bacteria | 14187 |
| 133 | Ga0466723_000787 | 3300042618 | Bacteria | 9437 |
| 134 | Ga0466728_075455 | 3300042620 | Bacteria | 1676 |
| 135 | JGI24702J35022_10043051 | 3300002462 | Bacteria | 2404 |
| 136 | JGI24702J35022_10207638 | 3300002462 | Bacteria | 1123 |
| 137 | Ga0466694_065229 | 3300042594 | Bacteria | 6305 |
| 138 | Ga0466707_015371 | 3300042601 | Bacteria | 12702 |
| 139 | Ga0466707_048019 | 3300042601 | Bacteria | 24477 |
| 140 | Ga0466707_123374 | 3300042601 | Bacteria | 47792 |
| 141 | Ga0466733_079392 | 3300042659 | Bacteria | 1527 |
| 142 | Ga0466704_509593 | 3300042643 | Bacteria | 5886 |
| 143 | Ga0123355_10006092 | 3300009826 | Bacteria | 17785 |
| 144 | Ga0123353_10081245 | 3300010167 | Bacteria | 5212 |
| 145 | Ga0123353_10349057 | 3300010167 | Bacteria | 2230 |
| 146 | Ga0123353_10438125 | 3300010167 | Bacteria | 1929 |
| 147 | Ga0123353_10482402 | 3300010167 | Bacteria | 1814 |
| 148 | Ga0466723_026796 | 3300042618 | Bacteria | 3340 |
| 149 | JGI24702J35022_10089162 | 3300002462 | Bacteria | 1677 |
| 150 | JGI24705J35276_12233791 | 3300002504 | Bacteria | 5068 |
| 151 | Ga0466696_019763 | 3300042596 | Bacteria | 9088 |
| 152 | Ga0466707_027935 | 3300042601 | Bacteria | 35771 |
| 153 | Ga0466707_157113 | 3300042601 | Bacteria | 16101 |
| 154 | Ga0466717_142090 | 3300042604 | Unclassified | 2755 |
| 155 | Ga0466717_156583 | 3300042604 | Bacteria | 2676 |
| 156 | Ga0466719_033432 | 3300042606 | Bacteria | 7666 |
| 157 | Ga0466722_048093 | 3300042609 | Bacteria | 2017 |
| 158 | Ga0466722_263218 | 3300042609 | Unclassified | 2772 |
| 159 | Ga0123355_10109342 | 3300009826 | Bacteria | 4324 |
| 160 | Ga0123356_10436931 | 3300010049 | Bacteria | 1454 |
| 161 | Ga0123353_10108216 | 3300010167 | Bacteria | 4480 |
| 162 | Ga0123353_10271727 | 3300010167 | Bacteria | 2611 |
| 163 | Ga0123353_10616723 | 3300010167 | Bacteria | 1546 |
| 164 | Ga0123353_10628316 | 3300010167 | Bacteria | 1527 |
| 165 | Ga0123353_11083233 | 3300010167 | Unclassified | 1066 |
| 166 | Ga0466718_030200 | 3300042617 | Bacteria | 5943 |
| 167 | Ga0466718_049198 | 3300042617 | Bacteria | 3961 |
| 168 | Ga0466729_149709 | 3300042621 | Bacteria | 1773 |
| 169 | IMNBL1DRAFT_c0066266 | 3300000062 | Bacteria | 1061 |
| 170 | Ga0072940_1106620 | 3300005200 | Bacteria | 1352 |
| 171 | Ga0415639_125353 | 3300038395 | Unclassified | 2649 |
| 172 | Ga0466693_333243 | 3300042592 | Bacteria | 2307 |
| 173 | Ga0466694_056483 | 3300042594 | Bacteria | 6701 |
| 174 | Ga0466696_155334 | 3300042596 | Bacteria | 21838 |
| 175 | Ga0466696_205872 | 3300042596 | Bacteria | 3136 |
| 176 | Ga0466699_291570 | 3300042597 | Archaea | 1365 |
| 177 | Ga0466707_056336 | 3300042601 | Bacteria | 1099 |
| 178 | Ga0466707_138040 | 3300042601 | Unclassified | 1341 |
| 179 | Ga0466707_216750 | 3300042601 | Bacteria | 2275 |
| 180 | Ga0466714_153967 | 3300042603 | Unclassified | 1563 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02361 | CbiQ | Cobalt transport protein | 32 | 227 | 0.81 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.