Protein Family IF00736
Metagenome
Isolate
129
Members
42
Samples
124
Scaffolds
288.58
Avg Length
Representative Sequence
- ID
- 3300002462|JGI24702J35022_10000258|JGI24702J35022_1000025810
- Length
- 327 aa
- Sequence
- LPPSINYDSKHELRAFLENRGLGMRKKYGQNFLINGVVRSRLLDTLDIQGGDSVWEIGSGIGAMTRGLLEKGALVTAFEIDKAFVQILREIFECESKTFKGKIILIEGDVLKTWQLVQVDEGKELFLLGNLPYNIAAALLADFVEKKRFFKRMVVTVQKEVALRMCAGPGTADYSSFSVLCSSAYKVTPIQTIGGSSFYPEPRVDSQAIRLDLIKGREELPKLFYPLVRSLFSNRRKTIKNTLSQFASSVIIRNPVNRRNTENHIPAGNGEFTPAVSVKEIAVEILRQAGISGDRRAETLEINEFRVLAALTEEMVSHEIGHCSPA*
Sample Types
Isolate
3.9%
Metagenome
96.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
42.5%
Kalotermitidae
32.5%
Unclassified
12.5%
Rhinotermitidae
7.5%
Hodotermitidae
2.5%
Termopsidae
2.5%
Taxonomy
Archaea
0
Bacteria
117
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 10 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 11 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 12 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 13 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 14 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 15 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 16 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 17 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 18 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 19 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 20 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 21 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 22 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 23 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 24 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 25 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 26 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 27 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 28 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 29 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 30 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 31 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 32 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 33 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 34 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 35 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 36 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 37 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 38 | 2781125686 | Treponema sp. Lab288P4bin22 | Isolate | Unclassified |
| 39 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 40 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 41 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 42 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_334694 | 3300042656 | Bacteria | 4903 |
| 2 | Ga0123357_10100904 | 3300009784 | Bacteria | 3722 |
| 3 | Ga0466712_227947 | 3300042614 | Bacteria | 2886 |
| 4 | Ga0466715_486104 | 3300042616 | Bacteria | 13693 |
| 5 | Ga0466718_121380 | 3300042617 | Bacteria | 2874 |
| 6 | Ga0466726_364894 | 3300042619 | Bacteria | 4777 |
| 7 | Ga0466722_203309 | 3300042609 | Bacteria | 4429 |
| 8 | Ga0264413_129385 | 3300024493 | Bacteria | 4396 |
| 9 | Ga0466691_000105 | 3300042593 | Bacteria | 7377 |
| 10 | Ga0466694_030859 | 3300042594 | Bacteria | 7597 |
| 11 | Ga0466694_355144 | 3300042594 | Bacteria | 3307 |
| 12 | Ga0466696_181188 | 3300042596 | Bacteria | 26938 |
| 13 | Ga0466699_295576 | 3300042597 | Unclassified | 2955 |
| 14 | Ga0466705_266113 | 3300042612 | Bacteria | 67009 |
| 15 | AustNasuHG_c1001692 | 3300000089 | Bacteria | 7966 |
| 16 | JGI24698J34947_10031227 | 3300002449 | Unclassified | 2806 |
| 17 | JGI24702J35022_10009400 | 3300002462 | Bacteria | 5488 |
| 18 | Ga0123354_10109259 | 3300010882 | Unclassified | 3666 |
| 19 | Ga0466711_082425 | 3300042615 | Bacteria | 10650 |
| 20 | Ga0466711_517584 | 3300042615 | Bacteria | 5852 |
| 21 | Ga0466715_087508 | 3300042616 | Bacteria | 2737 |
| 22 | Ga0466694_174195 | 3300042594 | Bacteria | 4351 |
| 23 | Ga0466696_291562 | 3300042596 | Bacteria | 5267 |
| 24 | Ga0466699_365074 | 3300042597 | Bacteria | 5122 |
| 25 | Ga0466709_258825 | 3300042648 | Bacteria | 56335 |
| 26 | Ga0466708_041688 | 3300042652 | Bacteria | 40918 |
| 27 | JGI24698J34947_10003067 | 3300002449 | Bacteria | 9047 |
| 28 | JGI24698J34947_10004849 | 3300002449 | Bacteria | 7363 |
| 29 | JGI24698J34947_10052565 | 3300002449 | Bacteria | 2044 |
| 30 | JGI24698J34947_10073517 | 3300002449 | Unclassified | 1631 |
| 31 | JGI24698J34947_10090798 | 3300002449 | Unclassified | 1402 |
| 32 | JGI24695J34938_10023594 | 3300002450 | Bacteria | 2964 |
| 33 | JGI24702J35022_10170154 | 3300002462 | Bacteria | 1232 |
| 34 | Ga0072941_1001116 | 3300005201 | Bacteria | 50216 |
| 35 | Ga0123357_10018915 | 3300009784 | Bacteria | 9165 |
| 36 | Ga0466715_245983 | 3300042616 | Bacteria | 27497 |
| 37 | Ga0466723_076742 | 3300042618 | Bacteria | 9218 |
| 38 | Ga0466723_097923 | 3300042618 | Bacteria | 10050 |
| 39 | Ga0466723_182389 | 3300042618 | Bacteria | 10534 |
| 40 | Ga0466726_410480 | 3300042619 | Bacteria | 1481 |
| 41 | Ga0466728_154341 | 3300042620 | Bacteria | 6448 |
| 42 | Ga0466690_067972 | 3300042590 | Bacteria | 4907 |
| 43 | Ga0466694_033250 | 3300042594 | Bacteria | 4510 |
| 44 | Ga0466702_154134 | 3300042635 | Bacteria | 22134 |
| 45 | Ga0466703_124691 | 3300042636 | Bacteria | 13494 |
| 46 | Ga0466704_140178 | 3300042643 | Bacteria | 60046 |
| 47 | Ga0466704_262896 | 3300042643 | Bacteria | 4441 |
| 48 | Ga0466709_287862 | 3300042648 | Bacteria | 12879 |
| 49 | JGI24698J34947_10000295 | 3300002449 | Bacteria | 21660 |
| 50 | JGI24698J34947_10008964 | 3300002449 | Bacteria | 5486 |
| 51 | JGI24698J34947_10027200 | 3300002449 | Bacteria | 3035 |
| 52 | JGI24698J34947_10120174 | 3300002449 | Bacteria | 1142 |
| 53 | Ga0466732_159474 | 3300042656 | Bacteria | 10234 |
| 54 | Ga0466733_198661 | 3300042659 | Bacteria | 1862 |
| 55 | Ga0123354_10081796 | 3300010882 | Bacteria | 4558 |
| 56 | Ga0466712_022565 | 3300042614 | Bacteria | 13421 |
| 57 | Ga0466712_074391 | 3300042614 | Bacteria | 3344 |
| 58 | Ga0466712_297429 | 3300042614 | Bacteria | 2879 |
| 59 | Ga0466711_490189 | 3300042615 | Bacteria | 8751 |
| 60 | Ga0466720_102576 | 3300042607 | Bacteria | 3123 |
| 61 | Ga0466692_020328 | 3300042591 | Bacteria | 2037 |
| 62 | Ga0466692_111092 | 3300042591 | Bacteria | 21683 |
| 63 | Ga0466699_136408 | 3300042597 | Bacteria | 2711 |
| 64 | Ga0466709_298725 | 3300042648 | Bacteria | 15153 |
| 65 | Ga0466708_054644 | 3300042652 | Bacteria | 6025 |
| 66 | Ga0466708_111332 | 3300042652 | Bacteria | 6185 |
| 67 | JGI24698J34947_10005904 | 3300002449 | Unclassified | 6713 |
| 68 | JGI24698J34947_10054307 | 3300002449 | Unclassified | 2001 |
| 69 | Ga0123353_10041130 | 3300010167 | Bacteria | 7298 |
| 70 | Ga0466712_054107 | 3300042614 | Bacteria | 23105 |
| 71 | Ga0466715_497346 | 3300042616 | Bacteria | 4000 |
| 72 | Ga0466694_089437 | 3300042594 | Bacteria | 1545 |
| 73 | Ga0466696_106850 | 3300042596 | Bacteria | 9467 |
| 74 | Ga0466703_408137 | 3300042636 | Bacteria | 14729 |
| 75 | Ga0466708_130237 | 3300042652 | Bacteria | 5950 |
| 76 | JGI24698J34947_10013995 | 3300002449 | Bacteria | 4372 |
| 77 | JGI24698J34947_10070294 | 3300002449 | Bacteria | 1686 |
| 78 | JGI24702J35022_10008920 | 3300002462 | Unclassified | 5655 |
| 79 | Ga0123353_10097417 | 3300010167 | Bacteria | 4740 |
| 80 | Ga0123353_10388340 | 3300010167 | Unclassified | 2084 |
| 81 | Ga0466712_032544 | 3300042614 | Bacteria | 8137 |
| 82 | Ga0466712_120010 | 3300042614 | Bacteria | 41166 |
| 83 | Ga0466715_011427 | 3300042616 | Bacteria | 9572 |
| 84 | Ga0466723_150782 | 3300042618 | Bacteria | 3623 |
| 85 | Ga0466728_012816 | 3300042620 | Bacteria | 10045 |
| 86 | Ga0466728_015254 | 3300042620 | Bacteria | 13514 |
| 87 | Ga0466728_125635 | 3300042620 | Bacteria | 5793 |
| 88 | Ga0466706_087379 | 3300042599 | Bacteria | 18943 |
| 89 | Ga0466716_408912 | 3300042605 | Bacteria | 6529 |
| 90 | Ga0264413_104241 | 3300024493 | Bacteria | 12765 |
| 91 | Ga0456237_0014055 | 3300041968 | Bacteria | 1142 |
| 92 | Ga0466691_121161 | 3300042593 | Bacteria | 15632 |
| 93 | Ga0466699_092734 | 3300042597 | Bacteria | 9948 |
| 94 | Ga0466699_429209 | 3300042597 | Bacteria | 8849 |
| 95 | Ga0466703_147374 | 3300042636 | Bacteria | 2029 |
| 96 | Ga0466703_319065 | 3300042636 | Bacteria | 1258 |
| 97 | Ga0466704_041141 | 3300042643 | Bacteria | 9848 |
| 98 | Ga0466704_073166 | 3300042643 | Unclassified | 7664 |
| 99 | JGI24698J34947_10014153 | 3300002449 | Bacteria | 4344 |
| 100 | Ga0466732_112754 | 3300042656 | Unclassified | 1507 |
| 101 | Ga0123353_10087807 | 3300010167 | Bacteria | 5009 |
| 102 | Ga0466712_179692 | 3300042614 | Bacteria | 22785 |
| 103 | Ga0466728_082193 | 3300042620 | Bacteria | 4920 |
| 104 | Ga0466720_014301 | 3300042607 | Bacteria | 6254 |
| 105 | Ga0466720_075626 | 3300042607 | Bacteria | 1313 |
| 106 | Ga0415639_013921 | 3300038395 | Bacteria | 15151 |
| 107 | Ga0466692_061904 | 3300042591 | Unclassified | 2546 |
| 108 | Ga0466694_356811 | 3300042594 | Bacteria | 1143 |
| 109 | Ga0466705_242261 | 3300042612 | Bacteria | 6987 |
| 110 | Ga0466702_104038 | 3300042635 | Bacteria | 9127 |
| 111 | JGI24698J34947_10041493 | 3300002449 | Bacteria | 2370 |
| 112 | JGI24702J35022_10000258 | 3300002462 | Bacteria | 30271 |
| 113 | Ga0466732_294168 | 3300042656 | Bacteria | 2480 |
| 114 | Ga0466718_012848 | 3300042617 | Bacteria | 2730 |
| 115 | Ga0466723_026390 | 3300042618 | Bacteria | 14641 |
| 116 | Ga0466728_290049 | 3300042620 | Bacteria | 3688 |
| 117 | Ga0466722_110028 | 3300042609 | Bacteria | 13376 |
| 118 | Ga0466698_231125 | 3300042610 | Bacteria | 1464 |
| 119 | Ga0466692_155123 | 3300042591 | Bacteria | 1466 |
| 120 | Ga0466699_116497 | 3300042597 | Bacteria | 8549 |
| 121 | Ga0466699_296050 | 3300042597 | Bacteria | 3518 |
| 122 | Ga0466708_138154 | 3300042652 | Bacteria | 6187 |
| 123 | AustNasuHG_c1000544 | 3300000089 | Bacteria | 13234 |
| 124 | Ga0123357_10000408 | 3300009784 | Bacteria | 40971 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00398 | RrnaAD | Ribosomal RNA adenine dimethylase | 24 | 248 | 0.93 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.