Protein Family IF00702
Metagenome
Metatranscriptome
Isolate
260
Members
62
Samples
237
Scaffolds
154.17
Avg Length
Representative Sequence
- ID
- 3300002450|JGI24695J34938_10042970|JGI24695J34938_100429702
- Length
- 181 aa
- Sequence
- MWYYISKPVALYMRIWYAQGEQRYMRCPHCGTIEDKVIESRSLANGDSVRRRRECINCGYRFTSYEKIDERQFMVIKKDGRREPFDRVKLERGAVRALEKRPFSQMQIENLINEIEDETAILSKGSREISSSAIGDLLLEQLGKLDKVAYIRFASVYKQFNDLDEFIEEIKKVGVDNINT*
Sample Types
Isolate
8.8%
Metagenome
90.4%
MAG
0.0%
Metatranscriptome
0.8%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
45.8%
Unclassified
40.7%
Kalotermitidae
8.5%
Termopsidae
3.4%
Rhinotermitidae
1.7%
Taxonomy
Archaea
0
Bacteria
230
Eukaryota
0
Viruses
0
Unclassified
30
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 2 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 9 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 10 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 11 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 12 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 13 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 14 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 15 | 2781125653 | Treponema sp. Emb289P1bin107 | Isolate | Unclassified |
| 16 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 17 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 18 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 19 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 20 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 21 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 22 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 23 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 24 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 25 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 26 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 27 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 28 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 29 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 30 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 31 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 32 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 33 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 34 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 35 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 36 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 37 | 3300021227 | Termite gut microbial communities from nest from French Guiana - 18-5 mRNA SA | Metatranscriptome | Termitidae |
| 38 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 39 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 40 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 41 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 42 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 43 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 44 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 45 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 46 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 47 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 48 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 49 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 50 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 51 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 52 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 53 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 54 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 55 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 56 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 57 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 58 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 59 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 60 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 61 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 62 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_146398 | 3300042656 | Bacteria | 4891 |
| 2 | Ga0466732_215372 | 3300042656 | Bacteria | 6300 |
| 3 | Ga0264413_101618 | 3300024493 | Bacteria | 34035 |
| 4 | Ga0264413_117118 | 3300024493 | Unclassified | 2989 |
| 5 | Ga0415639_034166 | 3300038395 | Bacteria | 2579 |
| 6 | Ga0466694_391343 | 3300042594 | Bacteria | 2596 |
| 7 | Ga0466720_149293 | 3300042607 | Bacteria | 43020 |
| 8 | Ga0466720_238860 | 3300042607 | Bacteria | 102895 |
| 9 | Ga0466721_193171 | 3300042608 | Bacteria | 1744 |
| 10 | JGI24698J34947_10003773 | 3300002449 | Unclassified | 8258 |
| 11 | JGI24698J34947_10004556 | 3300002449 | Bacteria | 7551 |
| 12 | JGI24698J34947_10011752 | 3300002449 | Bacteria | 4808 |
| 13 | JGI24695J34938_10000203 | 3300002450 | Bacteria | 56250 |
| 14 | JGI24695J34938_10000314 | 3300002450 | Bacteria | 47830 |
| 15 | JGI24695J34938_10001055 | 3300002450 | Bacteria | 24985 |
| 16 | JGI24695J34938_10021725 | 3300002450 | Bacteria | 3132 |
| 17 | JGI24699J35502_10907876 | 3300002509 | Bacteria | 1064 |
| 18 | Ga0072941_1036854 | 3300005201 | Bacteria | 7725 |
| 19 | Ga0072941_1067403 | 3300005201 | Bacteria | 4024 |
| 20 | Ga0072941_1069619 | 3300005201 | Unclassified | 6389 |
| 21 | Ga0466731_222829 | 3300042622 | Bacteria | 1968 |
| 22 | Ga0466712_081362 | 3300042614 | Bacteria | 13619 |
| 23 | Ga0466712_184288 | 3300042614 | Bacteria | 3145 |
| 24 | Ga0466718_017834 | 3300042617 | Bacteria | 9955 |
| 25 | Ga0466726_007077 | 3300042619 | Bacteria | 1293 |
| 26 | Ga0123353_11730794 | 3300010167 | Bacteria | 781 |
| 27 | Ga0415639_026390 | 3300038395 | Bacteria | 12294 |
| 28 | Ga0466694_404305 | 3300042594 | Bacteria | 30558 |
| 29 | Ga0466721_189604 | 3300042608 | Bacteria | 5254 |
| 30 | Ga0466698_137499 | 3300042610 | Bacteria | 1176 |
| 31 | AustNasuHG_c1019038 | 3300000089 | Bacteria | 2258 |
| 32 | AustNasuHG_c1032495 | 3300000089 | Bacteria | 1443 |
| 33 | AustNasuHG_c1042811 | 3300000089 | Bacteria | 1072 |
| 34 | JGI24698J34947_10009409 | 3300002449 | Bacteria | 5367 |
| 35 | JGI24698J34947_10187971 | 3300002449 | Unclassified | 819 |
| 36 | JGI24695J34938_10000031 | 3300002450 | Bacteria | 105176 |
| 37 | JGI24695J34938_10000111 | 3300002450 | Bacteria | 72830 |
| 38 | JGI24695J34938_10001234 | 3300002450 | Bacteria | 22527 |
| 39 | JGI24695J34938_10002956 | 3300002450 | Bacteria | 12272 |
| 40 | JGI24695J34938_10003662 | 3300002450 | Unclassified | 10531 |
| 41 | JGI24695J34938_10056442 | 3300002450 | Unclassified | 1693 |
| 42 | JGI24695J34938_10088994 | 3300002450 | Bacteria | 1268 |
| 43 | Ga0072941_1004185 | 3300005201 | Bacteria | 50030 |
| 44 | Ga0072941_1035269 | 3300005201 | Bacteria | 4621 |
| 45 | Ga0072941_1078612 | 3300005201 | Bacteria | 3470 |
| 46 | Ga0074263_147439 | 3300005485 | Unclassified | 860 |
| 47 | Ga0466731_280968 | 3300042622 | Bacteria | 99887 |
| 48 | Ga0466702_154528 | 3300042635 | Bacteria | 1733 |
| 49 | Ga0466712_214850 | 3300042614 | Bacteria | 1532 |
| 50 | Ga0466715_331705 | 3300042616 | Bacteria | 1327 |
| 51 | Ga0466718_007793 | 3300042617 | Bacteria | 1067 |
| 52 | Ga0466718_015101 | 3300042617 | Bacteria | 2611 |
| 53 | Ga0466718_018065 | 3300042617 | Bacteria | 5686 |
| 54 | Ga0466718_046825 | 3300042617 | Bacteria | 19231 |
| 55 | Ga0123356_10000264 | 3300010049 | Bacteria | 60568 |
| 56 | Ga0123356_10338614 | 3300010049 | Bacteria | 1624 |
| 57 | Ga0264413_100883 | 3300024493 | Bacteria | 42424 |
| 58 | Ga0415639_016616 | 3300038395 | Bacteria | 2014 |
| 59 | Ga0466694_124661 | 3300042594 | Bacteria | 8830 |
| 60 | Ga0466720_187809 | 3300042607 | Bacteria | 34336 |
| 61 | AustNasuHG_c1002839 | 3300000089 | Bacteria | 6257 |
| 62 | AustNasuHG_c1013734 | 3300000089 | Bacteria | 2770 |
| 63 | AustNasuHG_c1019811 | 3300000089 | Unclassified | 2201 |
| 64 | JGI24698J34947_10002301 | 3300002449 | Unclassified | 10266 |
| 65 | JGI24698J34947_10019693 | 3300002449 | Unclassified | 3636 |
| 66 | JGI24698J34947_10020462 | 3300002449 | Bacteria | 3562 |
| 67 | JGI24698J34947_10026973 | 3300002449 | Bacteria | 3049 |
| 68 | JGI24698J34947_10293404 | 3300002449 | Unclassified | 589 |
| 69 | Ga0072940_1003601 | 3300005200 | Bacteria | 22114 |
| 70 | Ga0072941_1027014 | 3300005201 | Bacteria | 4138 |
| 71 | Ga0466735_211722 | 3300042624 | Bacteria | 1512 |
| 72 | Ga0466702_248985 | 3300042635 | Bacteria | 4074 |
| 73 | Ga0466712_046296 | 3300042614 | Bacteria | 40974 |
| 74 | Ga0466712_148280 | 3300042614 | Bacteria | 29446 |
| 75 | Ga0466712_165953 | 3300042614 | Bacteria | 35107 |
| 76 | Ga0466718_013803 | 3300042617 | Bacteria | 14134 |
| 77 | Ga0466718_128694 | 3300042617 | Bacteria | 2589 |
| 78 | Ga0466732_350497 | 3300042656 | Bacteria | 3220 |
| 79 | Ga0123356_10001084 | 3300010049 | Bacteria | 30121 |
| 80 | Ga0123356_10005224 | 3300010049 | Bacteria | 13259 |
| 81 | Ga0123356_10013414 | 3300010049 | Bacteria | 7910 |
| 82 | Ga0123356_10015945 | 3300010049 | Bacteria | 7186 |
| 83 | Ga0123356_10334372 | 3300010049 | Bacteria | 1633 |
| 84 | Ga0123353_11168640 | 3300010167 | Bacteria | 1014 |
| 85 | Ga0123353_13390988 | 3300010167 | Bacteria | 506 |
| 86 | Ga0255809_1017387 | 3300022820 | Bacteria | 554 |
| 87 | Ga0264413_150023 | 3300024493 | Bacteria | 2365 |
| 88 | Ga0466694_026120 | 3300042594 | Bacteria | 6852 |
| 89 | Ga0466694_089558 | 3300042594 | Bacteria | 2047 |
| 90 | Ga0466694_138067 | 3300042594 | Bacteria | 6375 |
| 91 | Ga0466699_306906 | 3300042597 | Bacteria | 9463 |
| 92 | Ga0466699_440239 | 3300042597 | Bacteria | 15780 |
| 93 | Ga0466700_236042 | 3300042600 | Bacteria | 7712 |
| 94 | Ga0466720_054773 | 3300042607 | Bacteria | 2901 |
| 95 | AustNasuHG_c1016060 | 3300000089 | Bacteria | 2512 |
| 96 | AustNasuHG_c1031765 | 3300000089 | Unclassified | 1483 |
| 97 | JGI24698J34947_10001372 | 3300002449 | Bacteria | 12799 |
| 98 | JGI24698J34947_10003098 | 3300002449 | Bacteria | 9007 |
| 99 | JGI24698J34947_10006869 | 3300002449 | Bacteria | 6255 |
| 100 | JGI24698J34947_10009680 | 3300002449 | Unclassified | 5282 |
| 101 | JGI24698J34947_10092689 | 3300002449 | Bacteria | 1381 |
| 102 | JGI24695J34938_10000007 | 3300002450 | Bacteria | 136740 |
| 103 | JGI24695J34938_10000831 | 3300002450 | Bacteria | 28719 |
| 104 | JGI24695J34938_10001099 | 3300002450 | Bacteria | 24405 |
| 105 | JGI24695J34938_10051569 | 3300002450 | Bacteria | 1799 |
| 106 | JGI24695J34938_10055126 | 3300002450 | Bacteria | 1720 |
| 107 | Ga0072940_1003640 | 3300005200 | Bacteria | 6879 |
| 108 | Ga0072941_1008302 | 3300005201 | Bacteria | 8194 |
| 109 | Ga0072941_1022262 | 3300005201 | Unclassified | 1201 |
| 110 | Ga0072941_1027012 | 3300005201 | Bacteria | 3918 |
| 111 | Ga0072941_1075395 | 3300005201 | Bacteria | 2307 |
| 112 | Ga0072941_1254302 | 3300005201 | Bacteria | 1727 |
| 113 | Ga0466731_154208 | 3300042622 | Bacteria | 2085 |
| 114 | Ga0466703_136634 | 3300042636 | Bacteria | 4785 |
| 115 | Ga0466712_036398 | 3300042614 | Bacteria | 26079 |
| 116 | Ga0466712_150784 | 3300042614 | Bacteria | 6974 |
| 117 | Ga0466712_152288 | 3300042614 | Unclassified | 7639 |
| 118 | Ga0466712_184057 | 3300042614 | Bacteria | 4303 |
| 119 | Ga0466712_265921 | 3300042614 | Bacteria | 33911 |
| 120 | Ga0466718_004830 | 3300042617 | Bacteria | 2511 |
| 121 | Ga0466732_133512 | 3300042656 | Bacteria | 2640 |
| 122 | Ga0123356_10045163 | 3300010049 | Bacteria | 4099 |
| 123 | Ga0123356_10169006 | 3300010049 | Bacteria | 2195 |
| 124 | Ga0123353_11619520 | 3300010167 | Bacteria | 816 |
| 125 | Ga0123353_12036992 | 3300010167 | Bacteria | 701 |
| 126 | Ga0466693_157196 | 3300042592 | Bacteria | 53244 |
| 127 | Ga0466693_360526 | 3300042592 | Bacteria | 4613 |
| 128 | Ga0466694_281971 | 3300042594 | Bacteria | 1538 |
| 129 | Ga0466707_296552 | 3300042601 | Bacteria | 2260 |
| 130 | AustNasuHG_c1004933 | 3300000089 | Bacteria | 4775 |
| 131 | JGI24698J34947_10001937 | 3300002449 | Bacteria | 11027 |
| 132 | JGI24698J34947_10004301 | 3300002449 | Bacteria | 7752 |
| 133 | JGI24698J34947_10013015 | 3300002449 | Unclassified | 4545 |
| 134 | JGI24698J34947_10015582 | 3300002449 | Bacteria | 4138 |
| 135 | JGI24698J34947_10075920 | 3300002449 | Unclassified | 1595 |
| 136 | JGI24695J34938_10000006 | 3300002450 | Bacteria | 141807 |
| 137 | JGI24695J34938_10002751 | 3300002450 | Bacteria | 12940 |
| 138 | JGI24695J34938_10007859 | 3300002450 | Bacteria | 6174 |
| 139 | JGI24695J34938_10013654 | 3300002450 | Bacteria | 4254 |
| 140 | JGI24700J35501_10930752 | 3300002508 | Bacteria | 21666 |
| 141 | Ga0072940_1025886 | 3300005200 | Bacteria | 3472 |
| 142 | Ga0466702_042253 | 3300042635 | Bacteria | 1862 |
| 143 | Ga0466702_066124 | 3300042635 | Bacteria | 16938 |
| 144 | Ga0466702_225887 | 3300042635 | Bacteria | 3003 |
| 145 | Ga0466712_072508 | 3300042614 | Bacteria | 4044 |
| 146 | Ga0466718_032368 | 3300042617 | Unclassified | 6386 |
| 147 | Ga0466723_341694 | 3300042618 | Bacteria | 1807 |
| 148 | Ga0123356_10032710 | 3300010049 | Bacteria | 4864 |
| 149 | Ga0123356_10133942 | 3300010049 | Bacteria | 2432 |
| 150 | Ga0123356_10388758 | 3300010049 | Bacteria | 1530 |
| 151 | Ga0123353_10382901 | 3300010167 | Bacteria | 2103 |
| 152 | Ga0264413_109941 | 3300024493 | Bacteria | 2930 |
| 153 | Ga0415639_034140 | 3300038395 | Bacteria | 2383 |
| 154 | Ga0415639_047859 | 3300038395 | Bacteria | 3607 |
| 155 | Ga0466699_006349 | 3300042597 | Bacteria | 1413 |
| 156 | Ga0466699_224192 | 3300042597 | Bacteria | 1068 |
| 157 | JGI24698J34947_10080555 | 3300002449 | Unclassified | 1529 |
| 158 | JGI24695J34938_10000104 | 3300002450 | Bacteria | 74204 |
| 159 | JGI24695J34938_10000593 | 3300002450 | Bacteria | 34874 |
| 160 | JGI24695J34938_10013333 | 3300002450 | Bacteria | 4321 |
| 161 | JGI24695J34938_10045539 | 3300002450 | Bacteria | 1946 |
| 162 | JGI24695J34938_10049894 | 3300002450 | Bacteria | 1838 |
| 163 | JGI24695J34938_10059933 | 3300002450 | Bacteria | 1626 |
| 164 | JGI24695J34938_10100199 | 3300002450 | Bacteria | 1184 |
| 165 | Ga0072940_1037323 | 3300005200 | Bacteria | 3580 |
| 166 | Ga0072941_1008284 | 3300005201 | Bacteria | 8149 |
| 167 | Ga0466702_008589 | 3300042635 | Bacteria | 1318 |
| 168 | Ga0466702_183078 | 3300042635 | Bacteria | 2928 |
| 169 | Ga0466702_200928 | 3300042635 | Unclassified | 1724 |
| 170 | Ga0466712_033000 | 3300042614 | Bacteria | 5143 |
| 171 | Ga0466718_039723 | 3300042617 | Bacteria | 4331 |
| 172 | Ga0466718_083839 | 3300042617 | Bacteria | 6801 |
| 173 | Ga0123356_10000062 | 3300010049 | Bacteria | 112695 |
| 174 | Ga0123356_10025809 | 3300010049 | Bacteria | 5523 |
| 175 | Ga0123356_10605196 | 3300010049 | Bacteria | 1261 |
| 176 | Ga0123353_10672494 | 3300010167 | Bacteria | 1460 |
| 177 | Ga0123353_10926390 | 3300010167 | Bacteria | 1182 |
| 178 | Ga0223688_1029502 | 3300021227 | Unclassified | 532 |
| 179 | Ga0415639_000465 | 3300038395 | Bacteria | 8104 |
| 180 | Ga0466690_308178 | 3300042590 | Bacteria | 2042 |
| 181 | Ga0466692_002820 | 3300042591 | Bacteria | 1161 |
| 182 | Ga0466694_356116 | 3300042594 | Bacteria | 11891 |
| 183 | Ga0466699_025880 | 3300042597 | Bacteria | 10597 |
| 184 | Ga0466717_006251 | 3300042604 | Bacteria | 1147 |
| 185 | Ga0466716_346482 | 3300042605 | Bacteria | 2962 |
| 186 | Ga0466720_009235 | 3300042607 | Bacteria | 5714 |
| 187 | Ga0466720_047509 | 3300042607 | Bacteria | 1000 |
| 188 | Ga0466720_109588 | 3300042607 | Bacteria | 12204 |
| 189 | Ga0466720_192856 | 3300042607 | Bacteria | 6496 |
| 190 | Ga0466698_265218 | 3300042610 | Unclassified | 1686 |
| 191 | Ga0466698_436277 | 3300042610 | Bacteria | 1697 |
| 192 | AustNasuHG_c1015733 | 3300000089 | Unclassified | 2546 |
| 193 | JGI24698J34947_10048338 | 3300002449 | Unclassified | 2155 |
| 194 | JGI24695J34938_10000145 | 3300002450 | Bacteria | 64417 |
| 195 | JGI24695J34938_10004741 | 3300002450 | Bacteria | 8797 |
| 196 | JGI24695J34938_10005214 | 3300002450 | Bacteria | 8203 |
| 197 | JGI24695J34938_10042970 | 3300002450 | Bacteria | 2019 |
| 198 | JGI24695J34938_10049095 | 3300002450 | Bacteria | 1856 |
| 199 | JGI24695J34938_10130051 | 3300002450 | Bacteria | 1026 |
| 200 | Ga0072941_1010614 | 3300005201 | Bacteria | 1143 |
| 201 | Ga0466731_258941 | 3300042622 | Bacteria | 1841 |
| 202 | Ga0466712_043648 | 3300042614 | Bacteria | 7919 |
| 203 | Ga0466715_071701 | 3300042616 | Bacteria | 16717 |
| 204 | Ga0466718_024402 | 3300042617 | Bacteria | 20794 |
| 205 | Ga0466718_127781 | 3300042617 | Bacteria | 5388 |
| 206 | Ga0466723_021252 | 3300042618 | Bacteria | 4580 |
| 207 | Ga0123355_10123233 | 3300009826 | Bacteria | 4016 |
| 208 | Ga0123355_10756154 | 3300009826 | Bacteria | 1097 |
| 209 | Ga0123356_10000085 | 3300010049 | Bacteria | 98249 |
| 210 | Ga0123356_10003531 | 3300010049 | Bacteria | 16355 |
| 211 | Ga0123356_10024756 | 3300010049 | Bacteria | 5646 |
| 212 | Ga0123356_10061686 | 3300010049 | Bacteria | 3502 |
| 213 | Ga0123356_11734805 | 3300010049 | Bacteria | 775 |
| 214 | Ga0466690_016535 | 3300042590 | Bacteria | 4045 |
| 215 | Ga0466693_225843 | 3300042592 | Bacteria | 2912 |
| 216 | Ga0466694_359308 | 3300042594 | Bacteria | 5112 |
| 217 | Ga0466700_388018 | 3300042600 | Bacteria | 1173 |
| 218 | AustNasuHG_c1001214 | 3300000089 | Bacteria | 9278 |
| 219 | FAAS_10000505 | 3300001880 | Unclassified | 750 |
| 220 | JGI24698J34947_10001859 | 3300002449 | Bacteria | 11270 |
| 221 | JGI24698J34947_10077935 | 3300002449 | Unclassified | 1565 |
| 222 | JGI24698J34947_10183695 | 3300002449 | Unclassified | 833 |
| 223 | JGI24695J34938_10005971 | 3300002450 | Bacteria | 7452 |
| 224 | JGI24695J34938_10006097 | 3300002450 | Bacteria | 7340 |
| 225 | JGI24695J34938_10008363 | 3300002450 | Unclassified | 5915 |
| 226 | JGI24702J35022_10017790 | 3300002462 | Bacteria | 3881 |
| 227 | Ga0072941_1010613 | 3300005201 | Bacteria | 3636 |
| 228 | Ga0072941_1022261 | 3300005201 | Bacteria | 8562 |
| 229 | Ga0072941_1125010 | 3300005201 | Bacteria | 1165 |
| 230 | Ga0466712_089290 | 3300042614 | Bacteria | 2082 |
| 231 | Ga0466712_118083 | 3300042614 | Bacteria | 55745 |
| 232 | Ga0466712_314077 | 3300042614 | Bacteria | 4204 |
| 233 | Ga0466718_070228 | 3300042617 | Bacteria | 6914 |
| 234 | Ga0466718_115728 | 3300042617 | Bacteria | 3140 |
| 235 | Ga0466718_147067 | 3300042617 | Unclassified | 1431 |
| 236 | Ga0466718_148538 | 3300042617 | Unclassified | 1381 |
| 237 | Ga0466718_165179 | 3300042617 | Bacteria | 22578 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.