Protein Family IF00694
Metagenome
Isolate
202
Members
52
Samples
201
Scaffolds
570.41
Avg Length
Representative Sequence
- ID
- 3300002450|JGI24695J34938_10036765|JGI24695J34938_100367651
- Length
- 636 aa
- Sequence
- MPFKYLTNVPRLFGSTIKQVKSNKLEISMPSRHIFLSTFCEKWLHVVACCDIIGFKMRCVIMYLKKATSKKTGRTHLSIAHGYRNSAGKSTSKTIKILGYLDELEKEYDDPIAHFTAVAAEMDKERLANKTISVTLEKDGQLERGAANRKNYGHVVFSKIYHELELDRFFKNARRHENFKFNTDAIMRLLVYTRLLYPGSKRAAILNKDMFFDNFNFSLDDVYDALTHFDKISSSVQQHLHEQVTRQYNRETDLVYYDVSNYYFEIDKQDEFRKKGAEKNNRKDPIVQMGLLLDKGGLPISYKLFPGNTHDSQTLMPVLSDIKKNFGVNRIISVADKGLNSGDNIAYATVLGDGYIYSKSVRGASAEFKKWMFDNDGYRYGADGFKIKSMVVPDALINVTTKHVGKRKYKKEHRVEQKWVVFYSKKYAERARHKREEAIAKAMKMIENPSKYRRTFDYGAAGYIKNLKVDKNSGEIISLDDTLILDIEKIKAEEMYDGYYAIVTSELDDTDEHIVDMYRGLWRIEDSFKVTKSVLGTRPIYLQLEEHINAHFLTCFISLLIARLVELRLGGKYTIANITDSLRKVACSNIDQNHWLFDYADEITDDMNAVFATDFGKRVMTLKEIKKNLGETKQR*
Sample Types
Isolate
0.5%
Metagenome
99.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
57.7%
Kalotermitidae
26.9%
Unclassified
5.8%
Rhinotermitidae
3.8%
Termopsidae
3.8%
Passalidae
1.9%
Taxonomy
Archaea
0
Bacteria
187
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 3 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 4 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 5 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 6 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 7 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 8 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 9 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 10 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 11 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 12 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 13 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 14 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 15 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 16 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 17 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 18 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 19 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 20 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 21 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 22 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 23 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 24 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 25 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 26 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 27 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 28 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 29 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 30 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 31 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 32 | 2820324456 | Unclassified Firmicutes Nt197P3bin80 | Isolate | Unclassified |
| 33 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 34 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 35 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 36 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 37 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 38 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 39 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 40 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 41 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 42 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 43 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 44 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 45 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 46 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 47 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 48 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 49 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 50 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 51 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 52 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_100390 | 3300042612 | Bacteria | 2585 |
| 2 | Ga0466710_002162 | 3300042613 | Bacteria | 2936 |
| 3 | Ga0466728_360204 | 3300042620 | Bacteria | 2151 |
| 4 | Ga0466700_458069 | 3300042600 | Bacteria | 2068 |
| 5 | Ga0466729_296430 | 3300042621 | Bacteria | 2327 |
| 6 | Ga0466731_008018 | 3300042622 | Bacteria | 2385 |
| 7 | Ga0466734_016258 | 3300042623 | Bacteria | 3154 |
| 8 | Ga0466734_150661 | 3300042623 | Bacteria | 2247 |
| 9 | Ga0466735_036217 | 3300042624 | Bacteria | 2180 |
| 10 | Ga0466702_331096 | 3300042635 | Bacteria | 2169 |
| 11 | Ga0466703_320718 | 3300042636 | Bacteria | 5813 |
| 12 | Ga0466704_099316 | 3300042643 | Bacteria | 2255 |
| 13 | Ga0466724_21655 | 3300042649 | Bacteria | 2149 |
| 14 | Ga0466725_215339 | 3300042654 | Bacteria | 2228 |
| 15 | Ga0466727_243606 | 3300042655 | Bacteria | 2081 |
| 16 | Ga0415639_155533 | 3300038395 | Bacteria | 2349 |
| 17 | Ga0466656_353676 | 3300042550 | Bacteria | 1993 |
| 18 | Ga0466657_333625 | 3300042582 | Bacteria | 1893 |
| 19 | Ga0466694_113666 | 3300042594 | Unclassified | 5027 |
| 20 | Ga0123356_10086274 | 3300010049 | Bacteria | 2979 |
| 21 | Ga0123356_10128246 | 3300010049 | Bacteria | 2481 |
| 22 | Ga0123356_10138130 | 3300010049 | Unclassified | 2400 |
| 23 | Ga0123353_10335159 | 3300010167 | Bacteria | 2288 |
| 24 | Ga0123353_10352719 | 3300010167 | Bacteria | 2216 |
| 25 | Ga0123354_10147668 | 3300010882 | Unclassified | 2868 |
| 26 | 2227570742 | 2225789004 | Bacteria | 2616 |
| 27 | Ga0466697_111831 | 3300042611 | Bacteria | 3050 |
| 28 | Ga0466718_166037 | 3300042617 | Bacteria | 2345 |
| 29 | Ga0466729_136962 | 3300042621 | Bacteria | 2296 |
| 30 | Ga0466700_016488 | 3300042600 | Bacteria | 2840 |
| 31 | Ga0466700_176320 | 3300042600 | Bacteria | 2501 |
| 32 | Ga0466716_492156 | 3300042605 | Bacteria | 4025 |
| 33 | Ga0466721_389566 | 3300042608 | Bacteria | 2140 |
| 34 | Ga0466722_059513 | 3300042609 | Bacteria | 2696 |
| 35 | Ga0466729_309295 | 3300042621 | Bacteria | 2056 |
| 36 | Ga0466734_056746 | 3300042623 | Bacteria | 2133 |
| 37 | Ga0466734_111974 | 3300042623 | Bacteria | 2074 |
| 38 | Ga0466702_091861 | 3300042635 | Bacteria | 2177 |
| 39 | Ga0466708_305064 | 3300042652 | Bacteria | 3057 |
| 40 | Ga0466708_338515 | 3300042652 | Bacteria | 3513 |
| 41 | Ga0466725_100614 | 3300042654 | Bacteria | 2330 |
| 42 | Ga0466656_275528 | 3300042550 | Bacteria | 1926 |
| 43 | Ga0466701_012954 | 3300042598 | Bacteria | 2476 |
| 44 | Ga0123357_10136701 | 3300009784 | Bacteria | 3028 |
| 45 | Ga0123356_10176931 | 3300010049 | Bacteria | 2151 |
| 46 | Ga0123353_10330182 | 3300010167 | Unclassified | 2309 |
| 47 | JGI24695J34938_10031889 | 3300002450 | Unclassified | 2440 |
| 48 | JGI24702J35022_10048944 | 3300002462 | Bacteria | 2251 |
| 49 | JGI24705J35276_12213647 | 3300002504 | Unclassified | 1931 |
| 50 | JGI24700J35501_10876212 | 3300002508 | Bacteria | 2347 |
| 51 | Ga0068305_10009653 | 3300005083 | Bacteria | 2422 |
| 52 | Ga0466733_106548 | 3300042659 | Bacteria | 2794 |
| 53 | Ga0466710_142790 | 3300042613 | Bacteria | 2167 |
| 54 | Ga0466710_205503 | 3300042613 | Bacteria | 2411 |
| 55 | Ga0466711_155976 | 3300042615 | Bacteria | 2975 |
| 56 | Ga0466715_092337 | 3300042616 | Bacteria | 1864 |
| 57 | Ga0466718_030895 | 3300042617 | Bacteria | 2185 |
| 58 | Ga0466701_043145 | 3300042598 | Bacteria | 2105 |
| 59 | Ga0466701_059404 | 3300042598 | Bacteria | 2007 |
| 60 | Ga0466714_049384 | 3300042603 | Bacteria | 2939 |
| 61 | Ga0466719_292498 | 3300042606 | Bacteria | 4235 |
| 62 | Ga0466697_012202 | 3300042611 | Bacteria | 2744 |
| 63 | Ga0466735_175112 | 3300042624 | Bacteria | 2137 |
| 64 | Ga0466702_052047 | 3300042635 | Bacteria | 2694 |
| 65 | Ga0466709_345495 | 3300042648 | Bacteria | 2279 |
| 66 | Ga0466708_255569 | 3300042652 | Bacteria | 2210 |
| 67 | Ga0466727_142082 | 3300042655 | Bacteria | 2966 |
| 68 | Ga0466727_229183 | 3300042655 | Bacteria | 3053 |
| 69 | Ga0466656_134004 | 3300042550 | Bacteria | 2871 |
| 70 | Ga0466656_145453 | 3300042550 | Bacteria | 2138 |
| 71 | Ga0466656_337191 | 3300042550 | Bacteria | 2305 |
| 72 | Ga0466691_057662 | 3300042593 | Bacteria | 3166 |
| 73 | Ga0466696_152006 | 3300042596 | Bacteria | 2239 |
| 74 | Ga0466696_282968 | 3300042596 | Bacteria | 2203 |
| 75 | Ga0123357_10223325 | 3300009784 | Bacteria | 2084 |
| 76 | Ga0123356_10061643 | 3300010049 | Bacteria | 3503 |
| 77 | Ga0123356_10111417 | 3300010049 | Bacteria | 2644 |
| 78 | Ga0123356_10150729 | 3300010049 | Unclassified | 2308 |
| 79 | Ga0123356_10223321 | 3300010049 | Bacteria | 1942 |
| 80 | Ga0123353_10210890 | 3300010167 | Bacteria | 3046 |
| 81 | Ga0123353_10249211 | 3300010167 | Bacteria | 2752 |
| 82 | Ga0123353_10329732 | 3300010167 | Bacteria | 2311 |
| 83 | JGI24702J35022_10063853 | 3300002462 | Bacteria | 1973 |
| 84 | JGI24705J35276_12226513 | 3300002504 | Bacteria | 2867 |
| 85 | Ga0466705_018596 | 3300042612 | Bacteria | 2163 |
| 86 | Ga0466733_122948 | 3300042659 | Bacteria | 2946 |
| 87 | Ga0466711_398143 | 3300042615 | Bacteria | 2116 |
| 88 | Ga0466723_045788 | 3300042618 | Bacteria | 4925 |
| 89 | Ga0466723_061446 | 3300042618 | Bacteria | 3425 |
| 90 | Ga0466700_038517 | 3300042600 | Bacteria | 2193 |
| 91 | Ga0466714_053244 | 3300042603 | Bacteria | 2095 |
| 92 | Ga0466734_148969 | 3300042623 | Bacteria | 2243 |
| 93 | Ga0466734_163663 | 3300042623 | Bacteria | 2292 |
| 94 | Ga0466704_543231 | 3300042643 | Bacteria | 2396 |
| 95 | Ga0466657_053539 | 3300042582 | Bacteria | 2168 |
| 96 | Ga0466657_192203 | 3300042582 | Bacteria | 1961 |
| 97 | Ga0466690_318262 | 3300042590 | Bacteria | 3891 |
| 98 | Ga0466693_301153 | 3300042592 | Bacteria | 2563 |
| 99 | Ga0466696_252316 | 3300042596 | Bacteria | 2688 |
| 100 | Ga0123355_10239922 | 3300009826 | Bacteria | 2570 |
| 101 | Ga0123353_10340217 | 3300010167 | Bacteria | 2266 |
| 102 | JGI24702J35022_10019271 | 3300002462 | Bacteria | 3710 |
| 103 | Ga0466697_233946 | 3300042611 | Bacteria | 2200 |
| 104 | Ga0466733_088214 | 3300042659 | Unclassified | 3317 |
| 105 | Ga0466710_253308 | 3300042613 | Bacteria | 2891 |
| 106 | Ga0466718_012934 | 3300042617 | Bacteria | 1933 |
| 107 | Ga0466723_007149 | 3300042618 | Bacteria | 2761 |
| 108 | Ga0466728_138107 | 3300042620 | Bacteria | 3010 |
| 109 | Ga0466700_205344 | 3300042600 | Bacteria | 1980 |
| 110 | Ga0466714_011175 | 3300042603 | Bacteria | 3799 |
| 111 | Ga0466717_193703 | 3300042604 | Bacteria | 2100 |
| 112 | Ga0466716_367116 | 3300042605 | Bacteria | 4323 |
| 113 | Ga0466716_548194 | 3300042605 | Unclassified | 2203 |
| 114 | Ga0466719_060152 | 3300042606 | Bacteria | 3525 |
| 115 | Ga0466722_232848 | 3300042609 | Bacteria | 2662 |
| 116 | Ga0466702_120834 | 3300042635 | Unclassified | 2315 |
| 117 | Ga0466725_004157 | 3300042654 | Unclassified | 2124 |
| 118 | Ga0466725_457729 | 3300042654 | Bacteria | 2351 |
| 119 | Ga0466691_114491 | 3300042593 | Bacteria | 2484 |
| 120 | Ga0466696_273766 | 3300042596 | Bacteria | 2959 |
| 121 | Ga0123357_10198320 | 3300009784 | Bacteria | 2292 |
| 122 | Ga0123355_10218638 | 3300009826 | Bacteria | 2745 |
| 123 | Ga0123355_10272349 | 3300009826 | Bacteria | 2350 |
| 124 | Ga0123356_10079291 | 3300010049 | Unclassified | 3101 |
| 125 | Ga0123356_10195903 | 3300010049 | Bacteria | 2056 |
| 126 | Ga0123353_10105809 | 3300010167 | Bacteria | 4534 |
| 127 | Ga0123353_10293795 | 3300010167 | Bacteria | 2486 |
| 128 | Ga0123353_10341334 | 3300010167 | Unclassified | 2262 |
| 129 | Ga0123354_10181041 | 3300010882 | Bacteria | 2406 |
| 130 | JGI24702J35022_10016116 | 3300002462 | Bacteria | 4103 |
| 131 | Ga0068305_10412525 | 3300005083 | Bacteria | 2220 |
| 132 | Ga0466697_120253 | 3300042611 | Bacteria | 3020 |
| 133 | Ga0466705_248609 | 3300042612 | Bacteria | 3097 |
| 134 | Ga0466705_341258 | 3300042612 | Bacteria | 2433 |
| 135 | Ga0466705_383531 | 3300042612 | Bacteria | 2178 |
| 136 | Ga0466710_008282 | 3300042613 | Bacteria | 2496 |
| 137 | Ga0466707_264622 | 3300042601 | Bacteria | 1640 |
| 138 | Ga0466707_390891 | 3300042601 | Bacteria | 2413 |
| 139 | Ga0466697_025597 | 3300042611 | Bacteria | 3709 |
| 140 | Ga0466729_274272 | 3300042621 | Bacteria | 2931 |
| 141 | Ga0466731_217067 | 3300042622 | Bacteria | 2001 |
| 142 | Ga0466734_014050 | 3300042623 | Bacteria | 2330 |
| 143 | Ga0466703_120391 | 3300042636 | Bacteria | 2960 |
| 144 | Ga0466725_450549 | 3300042654 | Bacteria | 2592 |
| 145 | Ga0466656_053294 | 3300042550 | Bacteria | 1806 |
| 146 | Ga0466693_007011 | 3300042592 | Bacteria | 1984 |
| 147 | Ga0466693_145604 | 3300042592 | Bacteria | 3224 |
| 148 | Ga0466694_217456 | 3300042594 | Unclassified | 2211 |
| 149 | Ga0466696_021245 | 3300042596 | Bacteria | 2270 |
| 150 | Ga0466696_021761 | 3300042596 | Bacteria | 2535 |
| 151 | Ga0123356_10093124 | 3300010049 | Bacteria | 2875 |
| 152 | Ga0123356_10111940 | 3300010049 | Bacteria | 2638 |
| 153 | Ga0123356_10126056 | 3300010049 | Bacteria | 2500 |
| 154 | Ga0123353_10267790 | 3300010167 | Bacteria | 2634 |
| 155 | Ga0123353_10375330 | 3300010167 | Bacteria | 2130 |
| 156 | Ga0123353_10404043 | 3300010167 | Bacteria | 2031 |
| 157 | JGI24695J34938_10043136 | 3300002450 | Bacteria | 2014 |
| 158 | JGI24705J35276_12215182 | 3300002504 | Bacteria | 1992 |
| 159 | JGI24705J35276_12223833 | 3300002504 | Bacteria | 2548 |
| 160 | Ga0466705_127093 | 3300042612 | Bacteria | 1631 |
| 161 | Ga0466723_269590 | 3300042618 | Bacteria | 7901 |
| 162 | Ga0466700_121935 | 3300042600 | Bacteria | 2134 |
| 163 | Ga0466734_080897 | 3300042623 | Bacteria | 2775 |
| 164 | Ga0466734_136660 | 3300042623 | Bacteria | 2124 |
| 165 | Ga0466703_209313 | 3300042636 | Bacteria | 2134 |
| 166 | Ga0466703_269797 | 3300042636 | Bacteria | 11024 |
| 167 | Ga0466704_117417 | 3300042643 | Bacteria | 2521 |
| 168 | Ga0466704_135507 | 3300042643 | Bacteria | 2174 |
| 169 | Ga0466657_400010 | 3300042582 | Bacteria | 2144 |
| 170 | Ga0466693_103825 | 3300042592 | Bacteria | 2039 |
| 171 | Ga0466693_159289 | 3300042592 | Bacteria | 2233 |
| 172 | JGI24695J34938_10036765 | 3300002450 | Bacteria | 2230 |
| 173 | JGI24702J35022_10035704 | 3300002462 | Bacteria | 2658 |
| 174 | Ga0466705_156778 | 3300042612 | Bacteria | 3017 |
| 175 | Ga0466705_354663 | 3300042612 | Bacteria | 4209 |
| 176 | Ga0466715_507823 | 3300042616 | Bacteria | 2398 |
| 177 | Ga0466718_060661 | 3300042617 | Bacteria | 2583 |
| 178 | Ga0466718_161185 | 3300042617 | Bacteria | 2335 |
| 179 | Ga0466728_036434 | 3300042620 | Bacteria | 2328 |
| 180 | Ga0466700_160039 | 3300042600 | Bacteria | 2043 |
| 181 | Ga0466721_164386 | 3300042608 | Bacteria | 2481 |
| 182 | Ga0466698_282649 | 3300042610 | Unclassified | 2925 |
| 183 | Ga0466734_009169 | 3300042623 | Bacteria | 2312 |
| 184 | Ga0466735_071419 | 3300042624 | Bacteria | 2761 |
| 185 | Ga0466703_005098 | 3300042636 | Bacteria | 4329 |
| 186 | Ga0466703_318337 | 3300042636 | Bacteria | 3203 |
| 187 | Ga0466708_152114 | 3300042652 | Bacteria | 4261 |
| 188 | Ga0466725_257552 | 3300042654 | Bacteria | 2701 |
| 189 | Ga0466725_379002 | 3300042654 | Bacteria | 2570 |
| 190 | Ga0466693_078927 | 3300042592 | Bacteria | 2169 |
| 191 | Ga0466693_338502 | 3300042592 | Bacteria | 2442 |
| 192 | Ga0123355_10340954 | 3300009826 | Bacteria | 1996 |
| 193 | Ga0123356_10183752 | 3300010049 | Bacteria | 2115 |
| 194 | Ga0123356_10186989 | 3300010049 | Bacteria | 2099 |
| 195 | Ga0123353_10306690 | 3300010167 | Bacteria | 2419 |
| 196 | Ga0123353_10319114 | 3300010167 | Bacteria | 2359 |
| 197 | Ga0123353_10359534 | 3300010167 | Bacteria | 2189 |
| 198 | Ga0123353_10399554 | 3300010167 | Bacteria | 2046 |
| 199 | Ga0123353_10470529 | 3300010167 | Bacteria | 1843 |
| 200 | Ga0123354_10169473 | 3300010882 | Bacteria | 2549 |
| 201 | JGI24696J40584_12948505 | 3300002834 | Bacteria | 2009 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01609 | DDE_Tnp_1 | Transposase DDE domain | 268 | 560 | 0.86 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.