Protein Family IF00691
Metagenome
Isolate
119
Members
40
Samples
113
Scaffolds
254.08
Avg Length
Representative Sequence
- ID
- 3300002450|JGI24695J34938_10031352|JGI24695J34938_100313522
- Length
- 286 aa
- Sequence
- MNNYYELLGVRHDASAAEIKKAFREKAKQLHPDIAGSGGEAESRMRKLLTAYETLSNGQRRYEYDRAYSRFIKVSAFDYRSWLRERVDPASQAKLVFFDLLHLEEDEAIALWRKNGGINFPMEQYLGREDWMDCAFILAEELDRRGDQYEAFRLLVYIVSEERRLPYFRHFTEEIEKLVREIVRLRLRPQVDDETWVECMETLLTLGFPARDERFWMRSLAQALSALGDHSGAEQIRREAAKRGFSGKQAPDQXGADKPPPDDLPGEPYDEPAKPPRKRKETVKQ*
Sample Types
Isolate
5.0%
Metagenome
95.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
44.7%
Kalotermitidae
23.7%
Unclassified
15.8%
Rhinotermitidae
7.9%
Termopsidae
7.9%
Taxonomy
Archaea
0
Bacteria
107
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 4 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 5 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 6 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 7 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 8 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 9 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 10 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 11 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 12 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 13 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 14 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 15 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 16 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 17 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 18 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 19 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 20 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 21 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 22 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 23 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 24 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 25 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 26 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 27 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 28 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 29 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 30 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 31 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 32 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 33 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 34 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 35 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 36 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 37 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 38 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 39 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 40 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466712_139400 | 3300042614 | Bacteria | 1150 |
| 2 | Ga0466699_063562 | 3300042597 | Bacteria | 30414 |
| 3 | Ga0466699_069260 | 3300042597 | Bacteria | 25440 |
| 4 | Ga0466699_085620 | 3300042597 | Bacteria | 3006 |
| 5 | AustNasuHG_c1000295 | 3300000089 | Bacteria | 17341 |
| 6 | AustNasuHG_c1023939 | 3300000089 | Bacteria | 1942 |
| 7 | JGI24698J34947_10052777 | 3300002449 | Bacteria | 2038 |
| 8 | JGI24698J34947_10086222 | 3300002449 | Bacteria | 1456 |
| 9 | Ga0466705_040620 | 3300042612 | Unclassified | 11453 |
| 10 | Ga0466732_073199 | 3300042656 | Bacteria | 11526 |
| 11 | Ga0466705_458058 | 3300042612 | Bacteria | 18561 |
| 12 | Ga0466712_024974 | 3300042614 | Bacteria | 8800 |
| 13 | Ga0466712_212363 | 3300042614 | Bacteria | 1192 |
| 14 | Ga0466735_003553 | 3300042624 | Bacteria | 1839 |
| 15 | Ga0466703_270910 | 3300042636 | Unclassified | 4234 |
| 16 | Ga0466720_204152 | 3300042607 | Bacteria | 2162 |
| 17 | Ga0123353_10077148 | 3300010167 | Bacteria | 5354 |
| 18 | Ga0123354_10285063 | 3300010882 | Unclassified | 1595 |
| 19 | Ga0466699_433912 | 3300042597 | Bacteria | 1571 |
| 20 | AustNasuHG_c1010894 | 3300000089 | Bacteria | 3158 |
| 21 | JGI24698J34947_10052563 | 3300002449 | Unclassified | 2044 |
| 22 | JGI24695J34938_10003685 | 3300002450 | Bacteria | 10479 |
| 23 | Ga0466705_048053 | 3300042612 | Bacteria | 8422 |
| 24 | Ga0466718_063736 | 3300042617 | Bacteria | 2273 |
| 25 | Ga0466718_089163 | 3300042617 | Bacteria | 12524 |
| 26 | Ga0466735_151488 | 3300042624 | Bacteria | 2633 |
| 27 | Ga0466703_019028 | 3300042636 | Bacteria | 4843 |
| 28 | Ga0466714_033000 | 3300042603 | Bacteria | 1133 |
| 29 | Ga0466716_052529 | 3300042605 | Bacteria | 26815 |
| 30 | Ga0466720_080040 | 3300042607 | Bacteria | 3997 |
| 31 | Ga0466722_050851 | 3300042609 | Bacteria | 6646 |
| 32 | Ga0264413_118727 | 3300024493 | Bacteria | 7714 |
| 33 | Ga0466692_075477 | 3300042591 | Bacteria | 1529 |
| 34 | Ga0466696_086652 | 3300042596 | Bacteria | 4277 |
| 35 | Ga0466699_046468 | 3300042597 | Bacteria | 5613 |
| 36 | AustNasuHG_c1003406 | 3300000089 | Bacteria | 5742 |
| 37 | JGI24698J34947_10010175 | 3300002449 | Bacteria | 5157 |
| 38 | JGI24698J34947_10057982 | 3300002449 | Unclassified | 1919 |
| 39 | JGI24695J34938_10000633 | 3300002450 | Bacteria | 33528 |
| 40 | JGI24695J34938_10015209 | 3300002450 | Bacteria | 3954 |
| 41 | Ga0072940_1087665 | 3300005200 | Bacteria | 3016 |
| 42 | Ga0072941_1326199 | 3300005201 | Bacteria | 2185 |
| 43 | Ga0466705_060193 | 3300042612 | Bacteria | 4125 |
| 44 | Ga0466712_274710 | 3300042614 | Unclassified | 1071 |
| 45 | Ga0466715_016493 | 3300042616 | Bacteria | 28311 |
| 46 | Ga0466700_439555 | 3300042600 | Bacteria | 1931 |
| 47 | Ga0466713_085012 | 3300042602 | Bacteria | 16607 |
| 48 | Ga0466719_118876 | 3300042606 | Bacteria | 22691 |
| 49 | Ga0466719_367032 | 3300042606 | Bacteria | 12294 |
| 50 | Ga0466720_099193 | 3300042607 | Bacteria | 25962 |
| 51 | Ga0466722_179519 | 3300042609 | Bacteria | 5478 |
| 52 | Ga0123356_10001174 | 3300010049 | Bacteria | 28989 |
| 53 | Ga0123356_10238613 | 3300010049 | Bacteria | 1887 |
| 54 | Ga0123356_10337430 | 3300010049 | Bacteria | 1626 |
| 55 | Ga0264413_112996 | 3300024493 | Bacteria | 3252 |
| 56 | Ga0466691_215713 | 3300042593 | Bacteria | 14019 |
| 57 | Ga0466699_164414 | 3300042597 | Bacteria | 1183 |
| 58 | JGI24695J34938_10050431 | 3300002450 | Bacteria | 1825 |
| 59 | JGI24695J34938_10077661 | 3300002450 | Bacteria | 1377 |
| 60 | Ga0072940_1033034 | 3300005200 | Bacteria | 3734 |
| 61 | Ga0466732_341296 | 3300042656 | Bacteria | 5872 |
| 62 | Ga0466712_115215 | 3300042614 | Bacteria | 11270 |
| 63 | Ga0466700_044310 | 3300042600 | Bacteria | 1022 |
| 64 | Ga0466720_001658 | 3300042607 | Bacteria | 58257 |
| 65 | Ga0466720_030166 | 3300042607 | Unclassified | 9987 |
| 66 | Ga0466720_058527 | 3300042607 | Bacteria | 39738 |
| 67 | Ga0466720_148960 | 3300042607 | Bacteria | 10037 |
| 68 | Ga0466694_145515 | 3300042594 | Bacteria | 16023 |
| 69 | Ga0466699_090781 | 3300042597 | Bacteria | 2178 |
| 70 | JGI24695J34938_10031352 | 3300002450 | Bacteria | 2468 |
| 71 | Ga0466718_033936 | 3300042617 | Bacteria | 26795 |
| 72 | Ga0466723_080715 | 3300042618 | Bacteria | 10553 |
| 73 | Ga0466726_033825 | 3300042619 | Unclassified | 2701 |
| 74 | Ga0466720_005566 | 3300042607 | Bacteria | 5302 |
| 75 | Ga0466720_095437 | 3300042607 | Bacteria | 1418 |
| 76 | Ga0466720_172709 | 3300042607 | Unclassified | 1433 |
| 77 | Ga0466720_225869 | 3300042607 | Bacteria | 3118 |
| 78 | Ga0264413_114036 | 3300024493 | Unclassified | 4830 |
| 79 | Ga0466693_055803 | 3300042592 | Bacteria | 2846 |
| 80 | Ga0466694_286953 | 3300042594 | Bacteria | 41499 |
| 81 | JGI24698J34947_10053727 | 3300002449 | Bacteria | 2015 |
| 82 | JGI24698J34947_10084926 | 3300002449 | Unclassified | 1472 |
| 83 | JGI24695J34938_10003647 | 3300002450 | Bacteria | 10567 |
| 84 | Ga0072940_1000746 | 3300005200 | Bacteria | 8400 |
| 85 | Ga0466732_169458 | 3300042656 | Bacteria | 2164 |
| 86 | Ga0466715_305187 | 3300042616 | Bacteria | 8379 |
| 87 | Ga0466704_085569 | 3300042643 | Bacteria | 6138 |
| 88 | Ga0466727_217723 | 3300042655 | Bacteria | 3841 |
| 89 | Ga0466720_009232 | 3300042607 | Unclassified | 5348 |
| 90 | Ga0466720_078188 | 3300042607 | Bacteria | 8535 |
| 91 | Ga0466722_042328 | 3300042609 | Bacteria | 12765 |
| 92 | Ga0123356_10186230 | 3300010049 | Bacteria | 2102 |
| 93 | Ga0264413_100782 | 3300024493 | Bacteria | 9480 |
| 94 | Ga0456237_0024121 | 3300041968 | Bacteria | 831 |
| 95 | Ga0466693_011517 | 3300042592 | Bacteria | 4314 |
| 96 | JGI24698J34947_10142091 | 3300002449 | Bacteria | 1010 |
| 97 | JGI24695J34938_10018000 | 3300002450 | Bacteria | 3547 |
| 98 | JGI24695J34938_10032912 | 3300002450 | Bacteria | 2390 |
| 99 | Ga0466732_418581 | 3300042656 | Bacteria | 31652 |
| 100 | Ga0466718_168716 | 3300042617 | Bacteria | 20090 |
| 101 | Ga0466704_055068 | 3300042643 | Bacteria | 7796 |
| 102 | Ga0466704_494829 | 3300042643 | Bacteria | 21929 |
| 103 | Ga0466720_017944 | 3300042607 | Bacteria | 63542 |
| 104 | Ga0466720_088657 | 3300042607 | Bacteria | 10248 |
| 105 | Ga0466720_227986 | 3300042607 | Bacteria | 5732 |
| 106 | Ga0466720_228333 | 3300042607 | Bacteria | 9729 |
| 107 | Ga0123355_10133411 | 3300009826 | Bacteria | 3820 |
| 108 | Ga0123356_10195480 | 3300010049 | Bacteria | 2057 |
| 109 | Ga0123353_10491914 | 3300010167 | Bacteria | 1791 |
| 110 | Ga0466693_332331 | 3300042592 | Bacteria | 1343 |
| 111 | Ga0466696_258163 | 3300042596 | Bacteria | 6272 |
| 112 | JGI24698J34947_10007169 | 3300002449 | Bacteria | 6127 |
| 113 | JGI24695J34938_10023498 | 3300002450 | Bacteria | 2971 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00226 | DnaJ | DnaJ domain | 3 | 65 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.