Protein Family IF00678
Metagenome
Isolate
141
Members
50
Samples
135
Scaffolds
337.74
Avg Length
Representative Sequence
- ID
- 3300002450|JGI24695J34938_10022364|JGI24695J34938_100223642
- Length
- 383 aa
- Sequence
- MTPYSSILNWKQKQNKMRNSFSQLIFNQFRKNEIKLHELNYLFWECTRRCNLNCLHCGSDCKSSGSGIKDMPFDDFLKAILQIKKKYNSDKITVAITGGEPILREDLPQCGLALRKNGFRWGIVTNGYDYTHEVHEKLLASGMGSITVSLDGLEQNHXWLXXNDQSFKRAVNAIDLVASSPRXFYDVVTCVNKKNINELEEIKNFLISKKVKAWRLFTIWPIGRAAKNDDLLLDPPQLKQLMEFIAKTRESEEARFKNGSDDCIKVTFSCEAYIGEYELKVRDAYFFCRAGNSIASILIDGSISACPNINPCFIQGNIYKNDFLDVWENKFDVMRNRKWTKTGICENCDAFKNCNGGAMHLWNENKDSIITCIYSRLRTQAI*
Sample Types
Isolate
4.3%
Metagenome
95.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
56.2%
Kalotermitidae
18.8%
Unclassified
16.7%
Termopsidae
4.2%
Rhinotermitidae
2.1%
Passalidae
2.1%
Taxonomy
Archaea
0
Bacteria
130
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 2 | 2820735654 | Unclassified Bacteroidetes Th196P4bin9 | Isolate | Unclassified |
| 3 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 4 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 5 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 6 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 7 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 8 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 9 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 10 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 11 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 12 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 13 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 14 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 15 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 16 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 17 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 18 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 19 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 20 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 21 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 22 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 23 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 24 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 25 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 26 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 27 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 28 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 29 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 30 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 31 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 32 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 33 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 34 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 35 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 36 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 37 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 38 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 39 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 40 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 41 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 42 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 43 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 44 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 45 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 46 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 47 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 48 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 49 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 50 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_241925 | 3300042656 | Bacteria | 2074 |
| 2 | Ga0466733_197208 | 3300042659 | Bacteria | 2502 |
| 3 | Ga0466719_044216 | 3300042606 | Bacteria | 2017 |
| 4 | Ga0466698_390986 | 3300042610 | Bacteria | 2100 |
| 5 | Ga0466709_412106 | 3300042648 | Bacteria | 58576 |
| 6 | Ga0466712_031749 | 3300042614 | Bacteria | 6839 |
| 7 | Ga0466712_058148 | 3300042614 | Bacteria | 26296 |
| 8 | Ga0466712_060171 | 3300042614 | Bacteria | 3434 |
| 9 | Ga0466712_225480 | 3300042614 | Bacteria | 6551 |
| 10 | Ga0466728_031926 | 3300042620 | Bacteria | 3671 |
| 11 | Ga0123356_10035475 | 3300010049 | Unclassified | 4659 |
| 12 | Ga0123356_10297786 | 3300010049 | Unclassified | 1717 |
| 13 | Ga0415639_034537 | 3300038395 | Bacteria | 5168 |
| 14 | Ga0466693_178253 | 3300042592 | Bacteria | 7234 |
| 15 | Ga0466699_052137 | 3300042597 | Bacteria | 1555 |
| 16 | Ga0466699_149212 | 3300042597 | Bacteria | 34863 |
| 17 | JGI24698J34947_10047684 | 3300002449 | Bacteria | 2173 |
| 18 | JGI24698J34947_10105834 | 3300002449 | Unclassified | 1253 |
| 19 | JGI24698J34947_10105934 | 3300002449 | Unclassified | 1252 |
| 20 | JGI24702J35022_10017591 | 3300002462 | Bacteria | 3905 |
| 21 | Ga0466721_376201 | 3300042608 | Bacteria | 1547 |
| 22 | Ga0466697_000297 | 3300042611 | Bacteria | 2931 |
| 23 | Ga0466731_224413 | 3300042622 | Bacteria | 2497 |
| 24 | Ga0466702_067992 | 3300042635 | Bacteria | 2906 |
| 25 | Ga0466710_384094 | 3300042613 | Bacteria | 1466 |
| 26 | Ga0466712_083365 | 3300042614 | Bacteria | 4405 |
| 27 | Ga0466712_291374 | 3300042614 | Bacteria | 7122 |
| 28 | Ga0466712_295188 | 3300042614 | Bacteria | 2498 |
| 29 | Ga0466718_108228 | 3300042617 | Bacteria | 4632 |
| 30 | Ga0123357_10023261 | 3300009784 | Bacteria | 8326 |
| 31 | Ga0123353_10088497 | 3300010167 | Bacteria | 4987 |
| 32 | Ga0123353_11049455 | 3300010167 | Bacteria | 1089 |
| 33 | Ga0415639_059961 | 3300038395 | Bacteria | 6383 |
| 34 | Ga0466690_160085 | 3300042590 | Bacteria | 4688 |
| 35 | Ga0466694_220652 | 3300042594 | Bacteria | 1385 |
| 36 | Ga0466699_441845 | 3300042597 | Bacteria | 2283 |
| 37 | AustNasuHG_c1005401 | 3300000089 | Bacteria | 4564 |
| 38 | JGI24695J34938_10015839 | 3300002450 | Bacteria | 3854 |
| 39 | JGI24696J40584_12935750 | 3300002834 | Bacteria | 1566 |
| 40 | Ga0466697_204548 | 3300042611 | Bacteria | 1930 |
| 41 | Ga0466721_125554 | 3300042608 | Bacteria | 4277 |
| 42 | Ga0466721_176423 | 3300042608 | Bacteria | 2075 |
| 43 | Ga0466703_283708 | 3300042636 | Bacteria | 6059 |
| 44 | Ga0466704_065015 | 3300042643 | Bacteria | 2691 |
| 45 | Ga0466712_020340 | 3300042614 | Bacteria | 3045 |
| 46 | Ga0466712_029673 | 3300042614 | Bacteria | 11957 |
| 47 | Ga0466711_253684 | 3300042615 | Bacteria | 3149 |
| 48 | Ga0415639_021412 | 3300038395 | Bacteria | 3623 |
| 49 | Ga0466691_046048 | 3300042593 | Bacteria | 17163 |
| 50 | Ga0466699_213149 | 3300042597 | Bacteria | 3859 |
| 51 | JGI24698J34947_10081790 | 3300002449 | Bacteria | 1512 |
| 52 | JGI24695J34938_10022364 | 3300002450 | Bacteria | 3070 |
| 53 | Ga0466733_064811 | 3300042659 | Bacteria | 37557 |
| 54 | Ga0466714_038352 | 3300042603 | Bacteria | 65655 |
| 55 | Ga0123356_10228980 | 3300010049 | Bacteria | 1921 |
| 56 | Ga0264413_103947 | 3300024493 | Bacteria | 5508 |
| 57 | Ga0264413_104513 | 3300024493 | Unclassified | 6257 |
| 58 | Ga0466699_151890 | 3300042597 | Bacteria | 3386 |
| 59 | JGI24698J34947_10030984 | 3300002449 | Bacteria | 2817 |
| 60 | JGI24695J34938_10016909 | 3300002450 | Bacteria | 3694 |
| 61 | Ga0072941_1002914 | 3300005201 | Bacteria | 10853 |
| 62 | Ga0072941_1006641 | 3300005201 | Bacteria | 7071 |
| 63 | Ga0466714_020969 | 3300042603 | Bacteria | 5158 |
| 64 | Ga0466717_125408 | 3300042604 | Bacteria | 1234 |
| 65 | Ga0466731_286690 | 3300042622 | Bacteria | 1336 |
| 66 | Ga0466703_121868 | 3300042636 | Unclassified | 1875 |
| 67 | Ga0466703_416955 | 3300042636 | Bacteria | 9146 |
| 68 | Ga0466727_089187 | 3300042655 | Bacteria | 2900 |
| 69 | Ga0466712_018632 | 3300042614 | Bacteria | 4922 |
| 70 | Ga0466718_140413 | 3300042617 | Bacteria | 4550 |
| 71 | Ga0466718_152503 | 3300042617 | Bacteria | 5803 |
| 72 | Ga0123355_10142874 | 3300009826 | Bacteria | 3657 |
| 73 | Ga0123356_10013020 | 3300010049 | Bacteria | 8047 |
| 74 | Ga0123356_10327750 | 3300010049 | Bacteria | 1647 |
| 75 | Ga0123353_10001287 | 3300010167 | Bacteria | 30743 |
| 76 | Ga0123353_10673916 | 3300010167 | Unclassified | 1458 |
| 77 | Ga0123354_10195556 | 3300010882 | Bacteria | 2245 |
| 78 | Ga0123354_10243251 | 3300010882 | Bacteria | 1845 |
| 79 | Ga0466691_006190 | 3300042593 | Bacteria | 85330 |
| 80 | Ga0466699_045331 | 3300042597 | Bacteria | 2531 |
| 81 | Ga0466699_172440 | 3300042597 | Unclassified | 1525 |
| 82 | JGI24698J34947_10001477 | 3300002449 | Bacteria | 12411 |
| 83 | JGI24698J34947_10012956 | 3300002449 | Unclassified | 4556 |
| 84 | JGI24698J34947_10052371 | 3300002449 | Bacteria | 2048 |
| 85 | JGI24695J34938_10015557 | 3300002450 | Bacteria | 3900 |
| 86 | JGI24696J40584_12960862 | 3300002834 | Bacteria | 8960 |
| 87 | Ga0072941_1006640 | 3300005201 | Bacteria | 2653 |
| 88 | Ga0072941_1033883 | 3300005201 | Bacteria | 7905 |
| 89 | Ga0072941_1036489 | 3300005201 | Bacteria | 5954 |
| 90 | Ga0466707_376747 | 3300042601 | Bacteria | 2801 |
| 91 | Ga0466713_052610 | 3300042602 | Bacteria | 20946 |
| 92 | Ga0466703_017207 | 3300042636 | Bacteria | 22627 |
| 93 | Ga0123356_10039220 | 3300010049 | Bacteria | 4413 |
| 94 | Ga0123353_10992065 | 3300010167 | Bacteria | 1130 |
| 95 | Ga0466656_078722 | 3300042550 | Bacteria | 1311 |
| 96 | Ga0466694_211922 | 3300042594 | Bacteria | 1415 |
| 97 | Ga0466699_397181 | 3300042597 | Bacteria | 1965 |
| 98 | Ga0466699_419233 | 3300042597 | Bacteria | 3768 |
| 99 | JGI24698J34947_10042586 | 3300002449 | Bacteria | 2332 |
| 100 | JGI24695J34938_10014971 | 3300002450 | Bacteria | 3996 |
| 101 | JGI24695J34938_10016762 | 3300002450 | Bacteria | 3715 |
| 102 | JGI24695J34938_10017093 | 3300002450 | Bacteria | 3666 |
| 103 | JGI24695J34938_10019960 | 3300002450 | Bacteria | 3308 |
| 104 | Ga0466714_003882 | 3300042603 | Bacteria | 1990 |
| 105 | Ga0466709_090324 | 3300042648 | Bacteria | 29145 |
| 106 | Ga0466712_231562 | 3300042614 | Bacteria | 2456 |
| 107 | Ga0466712_246075 | 3300042614 | Bacteria | 3586 |
| 108 | Ga0466712_248595 | 3300042614 | Bacteria | 4285 |
| 109 | Ga0466726_044677 | 3300042619 | Bacteria | 3280 |
| 110 | Ga0123354_10000808 | 3300010882 | Bacteria | 34332 |
| 111 | Ga0123354_10121939 | 3300010882 | Bacteria | 3360 |
| 112 | Ga0264413_104512 | 3300024493 | Bacteria | 20893 |
| 113 | Ga0466656_009967 | 3300042550 | Bacteria | 4820 |
| 114 | Ga0466692_170380 | 3300042591 | Bacteria | 33735 |
| 115 | JGI24698J34947_10009491 | 3300002449 | Bacteria | 5340 |
| 116 | JGI24698J34947_10015084 | 3300002449 | Bacteria | 4208 |
| 117 | JGI24695J34938_10032161 | 3300002450 | Bacteria | 2426 |
| 118 | Ga0466705_123712 | 3300042612 | Bacteria | 2615 |
| 119 | Ga0466717_281955 | 3300042604 | Bacteria | 2781 |
| 120 | Ga0466709_018963 | 3300042648 | Bacteria | 10441 |
| 121 | Ga0466712_162813 | 3300042614 | Bacteria | 3027 |
| 122 | Ga0466718_029778 | 3300042617 | Bacteria | 2428 |
| 123 | Ga0123355_10110597 | 3300009826 | Bacteria | 4294 |
| 124 | Ga0123356_10098612 | 3300010049 | Bacteria | 2798 |
| 125 | Ga0123353_10001011 | 3300010167 | Bacteria | 34432 |
| 126 | Ga0123353_10009794 | 3300010167 | Bacteria | 13276 |
| 127 | Ga0123353_10483912 | 3300010167 | Bacteria | 1810 |
| 128 | Ga0466692_060665 | 3300042591 | Bacteria | 37700 |
| 129 | Ga0466693_026245 | 3300042592 | Bacteria | 2256 |
| 130 | Ga0466691_223009 | 3300042593 | Bacteria | 2163 |
| 131 | Ga0466694_121823 | 3300042594 | Bacteria | 10437 |
| 132 | 2227095555 | 2225789004 | Unclassified | 1816 |
| 133 | JGI24698J34947_10001245 | 3300002449 | Bacteria | 13310 |
| 134 | JGI24695J34938_10058106 | 3300002450 | Unclassified | 1660 |
| 135 | Ga0072941_1132477 | 3300005201 | Bacteria | 1326 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.