Protein Family IF00674
Metagenome
Isolate
128
Members
49
Samples
125
Scaffolds
138.8
Avg Length
Representative Sequence
- ID
- 3300002450|JGI24695J34938_10020662|JGI24695J34938_100206622
- Length
- 151 aa
- Sequence
- LTEQLRMKDKAFIDTNIIIYLYSEDEPEKQRISKKTFDNYECIVSTQVLNEFCNICFKKFNLSSDEVQYAINEIISQCNVLLIETENISQALDIHAKYGYGYFDSLIISSALSSNCKYLLTEDLTDGQIINDKLTIINILKSNSHQFSDN*
Sample Types
Isolate
2.3%
Metagenome
97.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
50.0%
Kalotermitidae
22.9%
Unclassified
12.5%
Termopsidae
6.2%
Rhinotermitidae
4.2%
Kiwaidae
2.1%
Hodotermitidae
2.1%
Taxonomy
Archaea
0
Bacteria
111
Eukaryota
0
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820220859 | Unclassified Firmicutes Th196P4bin59 | Isolate | Unclassified |
| 2 | 2820654856 | Unclassified Firmicutes Cu122P1bin2 | Isolate | Unclassified |
| 3 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 4 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 5 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 6 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 7 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 8 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 9 | 3300013007 | Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts | Metagenome | Kiwaidae |
| 10 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 11 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 12 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 13 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 14 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 15 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 16 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 17 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 18 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 19 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 20 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 21 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 22 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 23 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 24 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 25 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 26 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 27 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 28 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 29 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 30 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 31 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 32 | 2820716747 | Unclassified Fibrobacteres Nc150P3bin18 | Isolate | Unclassified |
| 33 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 34 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 35 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 36 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 37 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 38 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 39 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 40 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 41 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 42 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 43 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 44 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 45 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 46 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 47 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 48 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 49 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_014113 | 3300042612 | Unclassified | 1278 |
| 2 | Ga0466705_175123 | 3300042612 | Bacteria | 2114 |
| 3 | Ga0466707_248745 | 3300042601 | Bacteria | 1722 |
| 4 | Ga0466731_379438 | 3300042622 | Bacteria | 1062 |
| 5 | Ga0466709_218776 | 3300042648 | Unclassified | 1209 |
| 6 | Ga0123357_10184528 | 3300009784 | Bacteria | 2425 |
| 7 | Ga0123356_10818815 | 3300010049 | Bacteria | 1102 |
| 8 | Ga0123353_10461852 | 3300010167 | Unclassified | 1865 |
| 9 | Ga0123354_10412472 | 3300010882 | Bacteria | 1131 |
| 10 | Ga0123354_10554757 | 3300010882 | Bacteria | 864 |
| 11 | Ga0466693_375056 | 3300042592 | Bacteria | 1171 |
| 12 | Ga0466694_127520 | 3300042594 | Bacteria | 1127 |
| 13 | Ga0466715_194172 | 3300042616 | Bacteria | 2279 |
| 14 | Ga0466715_350642 | 3300042616 | Bacteria | 1081 |
| 15 | Ga0466715_411458 | 3300042616 | Bacteria | 1938 |
| 16 | Ga0466726_034007 | 3300042619 | Bacteria | 1035 |
| 17 | JGI24695J34938_10028512 | 3300002450 | Bacteria | 2623 |
| 18 | JGI24705J35276_11531020 | 3300002504 | Bacteria | 567 |
| 19 | JGI24705J35276_12046018 | 3300002504 | Bacteria | 911 |
| 20 | Ga0072941_1036883 | 3300005201 | Bacteria | 3184 |
| 21 | Ga0466697_231566 | 3300042611 | Bacteria | 2243 |
| 22 | Ga0466706_153802 | 3300042599 | Bacteria | 1497 |
| 23 | Ga0466700_226858 | 3300042600 | Bacteria | 1057 |
| 24 | Ga0466714_013336 | 3300042603 | Unclassified | 2046 |
| 25 | Ga0466722_085029 | 3300042609 | Bacteria | 1063 |
| 26 | Ga0466729_245078 | 3300042621 | Bacteria | 1588 |
| 27 | Ga0466709_348269 | 3300042648 | Bacteria | 1314 |
| 28 | Ga0123357_10253851 | 3300009784 | Bacteria | 1875 |
| 29 | Ga0123355_10286777 | 3300009826 | Unclassified | 2265 |
| 30 | Ga0123355_11618875 | 3300009826 | Bacteria | 623 |
| 31 | Ga0123353_11177673 | 3300010167 | Bacteria | 1008 |
| 32 | JGI24695J34938_10067724 | 3300002450 | Bacteria | 1501 |
| 33 | JGI24702J35022_10264017 | 3300002462 | Bacteria | 1005 |
| 34 | Ga0072941_1135618 | 3300005201 | Bacteria | 742 |
| 35 | Ga0466722_244505 | 3300042609 | Bacteria | 25844 |
| 36 | Ga0466709_344585 | 3300042648 | Bacteria | 2985 |
| 37 | Ga0466725_416821 | 3300042654 | Bacteria | 1362 |
| 38 | Ga0123356_11170494 | 3300010049 | Bacteria | 936 |
| 39 | Ga0123353_10138032 | 3300010167 | Bacteria | 3909 |
| 40 | Ga0466693_269738 | 3300042592 | Bacteria | 2150 |
| 41 | Ga0466694_373921 | 3300042594 | Bacteria | 1232 |
| 42 | Ga0466711_193486 | 3300042615 | Bacteria | 1011 |
| 43 | JGI24695J34938_10012102 | 3300002450 | Bacteria | 4598 |
| 44 | JGI24695J34938_10020662 | 3300002450 | Bacteria | 3236 |
| 45 | JGI24702J35022_10064486 | 3300002462 | Bacteria | 1964 |
| 46 | Ga0068302_10211587 | 3300005071 | Bacteria | 798 |
| 47 | Ga0068305_11067171 | 3300005083 | Bacteria | 662 |
| 48 | Ga0466707_083157 | 3300042601 | Bacteria | 2363 |
| 49 | Ga0466707_377098 | 3300042601 | Bacteria | 1203 |
| 50 | Ga0466714_008318 | 3300042603 | Bacteria | 1264 |
| 51 | Ga0466719_251405 | 3300042606 | Unclassified | 2567 |
| 52 | Ga0466722_033192 | 3300042609 | Bacteria | 1489 |
| 53 | Ga0466698_075546 | 3300042610 | Bacteria | 1717 |
| 54 | Ga0466704_346107 | 3300042643 | Bacteria | 18265 |
| 55 | Ga0123356_11852759 | 3300010049 | Bacteria | 750 |
| 56 | Ga0123353_11090745 | 3300010167 | Bacteria | 1061 |
| 57 | Ga0123354_10408534 | 3300010882 | Bacteria | 1141 |
| 58 | Ga0123354_10420462 | 3300010882 | Unclassified | 1111 |
| 59 | Ga0466691_039977 | 3300042593 | Bacteria | 2504 |
| 60 | Ga0466711_037585 | 3300042615 | Bacteria | 2140 |
| 61 | AustNasuHG_c1021705 | 3300000089 | Bacteria | 2074 |
| 62 | JGI24695J34938_10425144 | 3300002450 | Bacteria | 596 |
| 63 | Ga0466705_009804 | 3300042612 | Unclassified | 2379 |
| 64 | Ga0466705_098897 | 3300042612 | Bacteria | 1210 |
| 65 | Ga0466705_367075 | 3300042612 | Bacteria | 1964 |
| 66 | Ga0466701_088774 | 3300042598 | Bacteria | 4189 |
| 67 | Ga0466700_334197 | 3300042600 | Bacteria | 3014 |
| 68 | Ga0466700_430681 | 3300042600 | Bacteria | 1337 |
| 69 | Ga0466713_049769 | 3300042602 | Bacteria | 10781 |
| 70 | Ga0466719_076213 | 3300042606 | Bacteria | 2439 |
| 71 | Ga0466719_195703 | 3300042606 | Bacteria | 2923 |
| 72 | Ga0466731_173162 | 3300042622 | Bacteria | 1194 |
| 73 | Ga0466704_114729 | 3300042643 | Unclassified | 3545 |
| 74 | Ga0466709_245863 | 3300042648 | Bacteria | 1023 |
| 75 | Ga0466708_111463 | 3300042652 | Bacteria | 20235 |
| 76 | Ga0123353_10646328 | 3300010167 | Bacteria | 1499 |
| 77 | Ga0123353_10992435 | 3300010167 | Bacteria | 1129 |
| 78 | Ga0123354_10257255 | 3300010882 | Unclassified | 1753 |
| 79 | Ga0466690_224990 | 3300042590 | Unclassified | 4495 |
| 80 | Ga0466715_418057 | 3300042616 | Bacteria | 2299 |
| 81 | Ga0466723_267374 | 3300042618 | Bacteria | 3478 |
| 82 | JGI24702J35022_10091270 | 3300002462 | Bacteria | 1658 |
| 83 | Ga0466732_071292 | 3300042656 | Bacteria | 4877 |
| 84 | Ga0466721_082168 | 3300042608 | Bacteria | 1324 |
| 85 | Ga0466722_194208 | 3300042609 | Unclassified | 1274 |
| 86 | Ga0466708_183933 | 3300042652 | Bacteria | 1848 |
| 87 | Ga0123356_10161011 | 3300010049 | Bacteria | 2242 |
| 88 | Ga0123353_10074794 | 3300010167 | Bacteria | 5445 |
| 89 | Ga0123354_10092469 | 3300010882 | Bacteria | 4167 |
| 90 | Ga0157631_103855 | 3300013007 | Unclassified | 1201 |
| 91 | Ga0466691_200283 | 3300042593 | Bacteria | 1443 |
| 92 | Ga0466694_027229 | 3300042594 | Bacteria | 1764 |
| 93 | Ga0466711_195717 | 3300042615 | Bacteria | 2608 |
| 94 | Ga0466715_220869 | 3300042616 | Bacteria | 2118 |
| 95 | JGI24702J35022_10525184 | 3300002462 | Bacteria | 728 |
| 96 | Ga0466719_203145 | 3300042606 | Bacteria | 13504 |
| 97 | Ga0466704_230847 | 3300042643 | Bacteria | 8329 |
| 98 | Ga0466704_264049 | 3300042643 | Bacteria | 1022 |
| 99 | Ga0466704_356093 | 3300042643 | Bacteria | 3712 |
| 100 | Ga0466704_577847 | 3300042643 | Bacteria | 1973 |
| 101 | Ga0466708_104068 | 3300042652 | Bacteria | 3541 |
| 102 | Ga0466725_368310 | 3300042654 | Bacteria | 1255 |
| 103 | Ga0123356_10214444 | 3300010049 | Bacteria | 1977 |
| 104 | Ga0123356_12853789 | 3300010049 | Bacteria | 604 |
| 105 | Ga0123353_11916262 | 3300010167 | Bacteria | 730 |
| 106 | Ga0466691_212097 | 3300042593 | Bacteria | 1354 |
| 107 | Ga0466696_043849 | 3300042596 | Bacteria | 1710 |
| 108 | Ga0466718_098653 | 3300042617 | Bacteria | 2185 |
| 109 | AustNasuHG_c1015813 | 3300000089 | Unclassified | 2538 |
| 110 | Ga0466705_068466 | 3300042612 | Bacteria | 1702 |
| 111 | Ga0466733_011955 | 3300042659 | Bacteria | 1266 |
| 112 | Ga0466722_161998 | 3300042609 | Bacteria | 1732 |
| 113 | Ga0466731_227385 | 3300042622 | Bacteria | 3230 |
| 114 | Ga0466709_202397 | 3300042648 | Bacteria | 4144 |
| 115 | Ga0466709_251234 | 3300042648 | Unclassified | 2894 |
| 116 | Ga0466727_307332 | 3300042655 | Bacteria | 1469 |
| 117 | Ga0123357_10167932 | 3300009784 | Bacteria | 2606 |
| 118 | Ga0123355_10621715 | 3300009826 | Bacteria | 1273 |
| 119 | Ga0123356_10160686 | 3300010049 | Bacteria | 2243 |
| 120 | Ga0466691_173019 | 3300042593 | Bacteria | 1727 |
| 121 | Ga0466699_017859 | 3300042597 | Bacteria | 3042 |
| 122 | Ga0466711_342529 | 3300042615 | Unclassified | 1455 |
| 123 | AustNasuHG_c1033791 | 3300000089 | Unclassified | 1385 |
| 124 | JGI24702J35022_10329246 | 3300002462 | Bacteria | 908 |
| 125 | Ga0072940_1025984 | 3300005200 | Bacteria | 2440 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01850 | PIN | PIN domain | 12 | 123 | 0.9 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.