Protein Family IF00670
Metagenome
Isolate
241
Members
62
Samples
225
Scaffolds
261.16
Avg Length
Representative Sequence
- ID
- 3300002450|JGI24695J34938_10019645|JGI24695J34938_100196456
- Length
- 307 aa
- Sequence
- MVTGTFFFPDIVWKSLMLRXLRFGRFPSSYLFRFRQNGYHENQMNGELKVGLALTVPILLLVFAGFLGILGDYNEMHPERRFLPPSLAHPLGTDNFGRDVLRRVIAGSRHTITLAVFTVAGAVALGSALGLFAGYSGGIRDEIVMRLMDAISSFPGILFALVMVALMGNSQFTLFVALLVLFVPSFTRIMRSGALQYKHADFVLAERLLGASHVRILFAHILPNLAHSLLSASALGLSNAILAESAMSYLGLGIQPPHPSWGRMLSESQIFLFNAPWCALAPGGFIMLTVIGFHCLGNGLRRKFGD*
Sample Types
Isolate
6.6%
Metagenome
93.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.7%
Unclassified
28.3%
Kalotermitidae
21.7%
Rhinotermitidae
5.0%
Termopsidae
3.3%
Taxonomy
Archaea
2
Bacteria
219
Eukaryota
0
Viruses
0
Unclassified
20
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 2 | 2781125685 | Treponema sp. Lab288P1bin13 | Isolate | Unclassified |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 12 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 13 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 14 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 15 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 19 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 20 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 21 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 22 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 23 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 24 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 25 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 26 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 27 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 28 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 29 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 30 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 31 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 32 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 33 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 34 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 35 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 36 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 37 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 38 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 39 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 40 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 41 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 42 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 43 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 44 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 45 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 46 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 47 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 48 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 49 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 50 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 51 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 52 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 53 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 54 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 55 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 56 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 57 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 58 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 59 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 60 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 61 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 62 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_070521 | 3300042656 | Archaea | 2001 |
| 2 | Ga0264413_112193 | 3300024493 | Unclassified | 2280 |
| 3 | Ga0415639_083843 | 3300038395 | Bacteria | 3831 |
| 4 | Ga0466694_064514 | 3300042594 | Bacteria | 49364 |
| 5 | Ga0466694_219380 | 3300042594 | Bacteria | 1583 |
| 6 | Ga0466699_119518 | 3300042597 | Bacteria | 23384 |
| 7 | Ga0466699_380203 | 3300042597 | Bacteria | 1776 |
| 8 | Ga0466712_014215 | 3300042614 | Bacteria | 5234 |
| 9 | Ga0466712_102763 | 3300042614 | Unclassified | 1411 |
| 10 | Ga0466711_151948 | 3300042615 | Bacteria | 12150 |
| 11 | Ga0466718_009982 | 3300042617 | Bacteria | 3742 |
| 12 | Ga0466718_137894 | 3300042617 | Bacteria | 2418 |
| 13 | Ga0466718_146620 | 3300042617 | Bacteria | 4091 |
| 14 | Ga0466723_059873 | 3300042618 | Bacteria | 3037 |
| 15 | Ga0466728_331105 | 3300042620 | Bacteria | 3086 |
| 16 | Ga0466728_394235 | 3300042620 | Bacteria | 7156 |
| 17 | Ga0466720_033623 | 3300042607 | Bacteria | 30329 |
| 18 | Ga0466722_182322 | 3300042609 | Bacteria | 6345 |
| 19 | Ga0466698_054929 | 3300042610 | Bacteria | 1374 |
| 20 | Ga0466729_205419 | 3300042621 | Bacteria | 1710 |
| 21 | AustNasuHG_c1003327 | 3300000089 | Bacteria | 5798 |
| 22 | AustNasuHG_c1005312 | 3300000089 | Bacteria | 4603 |
| 23 | JGI24698J34947_10047155 | 3300002449 | Bacteria | 2188 |
| 24 | JGI24695J34938_10002423 | 3300002450 | Bacteria | 14301 |
| 25 | Ga0072941_1029546 | 3300005201 | Bacteria | 1679 |
| 26 | Ga0466705_233092 | 3300042612 | Bacteria | 15825 |
| 27 | Ga0466732_347723 | 3300042656 | Bacteria | 7156 |
| 28 | Ga0466732_423936 | 3300042656 | Bacteria | 4127 |
| 29 | Ga0466690_059456 | 3300042590 | Bacteria | 13079 |
| 30 | Ga0466692_044172 | 3300042591 | Bacteria | 8136 |
| 31 | Ga0466692_183044 | 3300042591 | Bacteria | 10484 |
| 32 | Ga0466693_023952 | 3300042592 | Bacteria | 6061 |
| 33 | Ga0466694_256730 | 3300042594 | Bacteria | 1161 |
| 34 | Ga0466699_054051 | 3300042597 | Unclassified | 1232 |
| 35 | Ga0466699_089215 | 3300042597 | Bacteria | 13125 |
| 36 | Ga0466699_356758 | 3300042597 | Bacteria | 2643 |
| 37 | Ga0466699_440952 | 3300042597 | Bacteria | 1998 |
| 38 | Ga0466712_053236 | 3300042614 | Bacteria | 1233 |
| 39 | Ga0466712_056000 | 3300042614 | Bacteria | 15563 |
| 40 | Ga0466712_193855 | 3300042614 | Bacteria | 2825 |
| 41 | Ga0466712_206980 | 3300042614 | Bacteria | 35802 |
| 42 | Ga0466718_002890 | 3300042617 | Bacteria | 2911 |
| 43 | Ga0466718_035446 | 3300042617 | Bacteria | 9996 |
| 44 | Ga0466723_006055 | 3300042618 | Bacteria | 37836 |
| 45 | Ga0466728_431513 | 3300042620 | Bacteria | 2947 |
| 46 | Ga0123356_10004910 | 3300010049 | Bacteria | 13724 |
| 47 | Ga0466707_019093 | 3300042601 | Bacteria | 28365 |
| 48 | Ga0466719_088290 | 3300042606 | Bacteria | 3359 |
| 49 | Ga0466703_243553 | 3300042636 | Bacteria | 7630 |
| 50 | Ga0466704_004141 | 3300042643 | Bacteria | 7719 |
| 51 | Ga0466709_296903 | 3300042648 | Bacteria | 6230 |
| 52 | Ga0466708_021691 | 3300042652 | Bacteria | 7356 |
| 53 | Ga0466708_267001 | 3300042652 | Unclassified | 4346 |
| 54 | Ga0466727_139913 | 3300042655 | Bacteria | 1090 |
| 55 | JGI24698J34947_10014914 | 3300002449 | Unclassified | 4231 |
| 56 | JGI24698J34947_10026461 | 3300002449 | Bacteria | 3083 |
| 57 | JGI24700J35501_10929980 | 3300002508 | Bacteria | 10867 |
| 58 | Ga0466705_312435 | 3300042612 | Bacteria | 3806 |
| 59 | Ga0466732_061431 | 3300042656 | Bacteria | 7767 |
| 60 | Ga0466732_296764 | 3300042656 | Bacteria | 4499 |
| 61 | Ga0466732_438191 | 3300042656 | Bacteria | 4051 |
| 62 | Ga0264413_100529 | 3300024493 | Bacteria | 17784 |
| 63 | Ga0466691_018347 | 3300042593 | Bacteria | 5640 |
| 64 | Ga0466694_149076 | 3300042594 | Bacteria | 1346 |
| 65 | Ga0466699_062745 | 3300042597 | Bacteria | 14044 |
| 66 | Ga0466699_403117 | 3300042597 | Unclassified | 1372 |
| 67 | Ga0466712_125000 | 3300042614 | Bacteria | 4254 |
| 68 | Ga0466711_089895 | 3300042615 | Bacteria | 5490 |
| 69 | Ga0466718_058409 | 3300042617 | Bacteria | 28002 |
| 70 | Ga0466726_166941 | 3300042619 | Bacteria | 3248 |
| 71 | Ga0123353_10040661 | 3300010167 | Bacteria | 7337 |
| 72 | Ga0123353_10364606 | 3300010167 | Bacteria | 2169 |
| 73 | Ga0466700_464746 | 3300042600 | Unclassified | 1263 |
| 74 | Ga0466720_185889 | 3300042607 | Bacteria | 5047 |
| 75 | Ga0466722_019464 | 3300042609 | Bacteria | 7101 |
| 76 | Ga0466731_251340 | 3300042622 | Bacteria | 16010 |
| 77 | Ga0466704_064466 | 3300042643 | Bacteria | 8919 |
| 78 | Ga0466727_241335 | 3300042655 | Bacteria | 6689 |
| 79 | JGI24698J34947_10007677 | 3300002449 | Bacteria | 5925 |
| 80 | JGI24698J34947_10011298 | 3300002449 | Bacteria | 4902 |
| 81 | JGI24698J34947_10032694 | 3300002449 | Unclassified | 2730 |
| 82 | JGI24695J34938_10014141 | 3300002450 | Bacteria | 4153 |
| 83 | Ga0072940_1066047 | 3300005200 | Bacteria | 1301 |
| 84 | Ga0466733_079802 | 3300042659 | Bacteria | 11288 |
| 85 | Ga0264413_102376 | 3300024493 | Bacteria | 55459 |
| 86 | Ga0466693_372467 | 3300042592 | Bacteria | 1802 |
| 87 | Ga0466699_188958 | 3300042597 | Bacteria | 11181 |
| 88 | Ga0466715_064175 | 3300042616 | Bacteria | 8585 |
| 89 | Ga0466718_008668 | 3300042617 | Bacteria | 8837 |
| 90 | Ga0466718_150835 | 3300042617 | Bacteria | 1690 |
| 91 | Ga0466728_208085 | 3300042620 | Bacteria | 6866 |
| 92 | Ga0466729_050829 | 3300042621 | Bacteria | 1947 |
| 93 | Ga0466720_024813 | 3300042607 | Unclassified | 3473 |
| 94 | Ga0466720_121528 | 3300042607 | Bacteria | 1711 |
| 95 | Ga0466722_029408 | 3300042609 | Bacteria | 5434 |
| 96 | Ga0466704_038386 | 3300042643 | Bacteria | 4585 |
| 97 | Ga0466704_225517 | 3300042643 | Bacteria | 11952 |
| 98 | AustNasuHG_c1033084 | 3300000089 | Unclassified | 1416 |
| 99 | JGI24698J34947_10008904 | 3300002449 | Unclassified | 5509 |
| 100 | JGI24698J34947_10061743 | 3300002449 | Bacteria | 1843 |
| 101 | JGI24695J34938_10000324 | 3300002450 | Bacteria | 46911 |
| 102 | JGI24695J34938_10004462 | 3300002450 | Bacteria | 9161 |
| 103 | JGI24695J34938_10052379 | 3300002450 | Bacteria | 1780 |
| 104 | Ga0466732_293355 | 3300042656 | Bacteria | 1099 |
| 105 | Ga0466732_402915 | 3300042656 | Bacteria | 9954 |
| 106 | Ga0466693_049301 | 3300042592 | Bacteria | 70349 |
| 107 | Ga0466694_015315 | 3300042594 | Bacteria | 10163 |
| 108 | Ga0466694_285138 | 3300042594 | Bacteria | 5137 |
| 109 | Ga0466699_001188 | 3300042597 | Bacteria | 3992 |
| 110 | Ga0466699_118341 | 3300042597 | Bacteria | 23800 |
| 111 | Ga0466699_188313 | 3300042597 | Bacteria | 2539 |
| 112 | Ga0466699_375240 | 3300042597 | Bacteria | 1007 |
| 113 | Ga0466699_443719 | 3300042597 | Bacteria | 2888 |
| 114 | Ga0466712_107931 | 3300042614 | Bacteria | 1286 |
| 115 | Ga0466715_033486 | 3300042616 | Bacteria | 13965 |
| 116 | Ga0466718_048247 | 3300042617 | Bacteria | 12966 |
| 117 | Ga0466723_026777 | 3300042618 | Bacteria | 14893 |
| 118 | Ga0466723_055081 | 3300042618 | Bacteria | 7869 |
| 119 | Ga0123357_10019276 | 3300009784 | Bacteria | 9087 |
| 120 | Ga0123357_10432711 | 3300009784 | Bacteria | 1161 |
| 121 | Ga0123353_10187491 | 3300010167 | Bacteria | 3269 |
| 122 | Ga0123354_10407687 | 3300010882 | Bacteria | 1143 |
| 123 | Ga0466700_042143 | 3300042600 | Bacteria | 1939 |
| 124 | Ga0466700_103369 | 3300042600 | Unclassified | 1035 |
| 125 | Ga0466700_195620 | 3300042600 | Bacteria | 1554 |
| 126 | Ga0466700_410231 | 3300042600 | Bacteria | 1714 |
| 127 | Ga0466719_337371 | 3300042606 | Bacteria | 1818 |
| 128 | Ga0466720_018095 | 3300042607 | Bacteria | 29151 |
| 129 | Ga0466720_022215 | 3300042607 | Bacteria | 39984 |
| 130 | Ga0466720_069808 | 3300042607 | Bacteria | 6167 |
| 131 | Ga0466720_080892 | 3300042607 | Bacteria | 26978 |
| 132 | Ga0466720_188314 | 3300042607 | Bacteria | 1600 |
| 133 | Ga0466722_232391 | 3300042609 | Bacteria | 4740 |
| 134 | Ga0466709_131657 | 3300042648 | Bacteria | 2037 |
| 135 | Ga0466727_267596 | 3300042655 | Bacteria | 1745 |
| 136 | JGI24698J34947_10045758 | 3300002449 | Unclassified | 2231 |
| 137 | JGI24698J34947_10083047 | 3300002449 | Unclassified | 1496 |
| 138 | JGI24698J34947_10083276 | 3300002449 | Unclassified | 1493 |
| 139 | JGI24695J34938_10015638 | 3300002450 | Bacteria | 3888 |
| 140 | Ga0072941_1082132 | 3300005201 | Bacteria | 4559 |
| 141 | Ga0074263_112419 | 3300005485 | Bacteria | 915 |
| 142 | Ga0466705_347093 | 3300042612 | Bacteria | 6775 |
| 143 | Ga0466705_369074 | 3300042612 | Bacteria | 2322 |
| 144 | Ga0415639_066161 | 3300038395 | Bacteria | 2399 |
| 145 | Ga0466692_165566 | 3300042591 | Bacteria | 2021 |
| 146 | Ga0466693_449303 | 3300042592 | Bacteria | 1319 |
| 147 | Ga0466699_064803 | 3300042597 | Bacteria | 12512 |
| 148 | Ga0466699_143205 | 3300042597 | Unclassified | 4545 |
| 149 | Ga0466711_337118 | 3300042615 | Bacteria | 3062 |
| 150 | Ga0466715_387864 | 3300042616 | Bacteria | 3864 |
| 151 | Ga0466718_026440 | 3300042617 | Bacteria | 4396 |
| 152 | Ga0466718_029729 | 3300042617 | Bacteria | 19146 |
| 153 | Ga0466723_167164 | 3300042618 | Bacteria | 3835 |
| 154 | Ga0123353_10872518 | 3300010167 | Bacteria | 1230 |
| 155 | Ga0466707_035338 | 3300042601 | Bacteria | 5498 |
| 156 | Ga0466707_338451 | 3300042601 | Bacteria | 31513 |
| 157 | Ga0466719_294292 | 3300042606 | Bacteria | 6134 |
| 158 | Ga0466720_030423 | 3300042607 | Bacteria | 5120 |
| 159 | Ga0466722_222643 | 3300042609 | Bacteria | 2144 |
| 160 | Ga0466698_233087 | 3300042610 | Bacteria | 1307 |
| 161 | Ga0466731_280968 | 3300042622 | Bacteria | 99887 |
| 162 | Ga0466703_144769 | 3300042636 | Bacteria | 15489 |
| 163 | Ga0466708_231733 | 3300042652 | Bacteria | 5483 |
| 164 | AustNasuHG_c1005375 | 3300000089 | Unclassified | 4575 |
| 165 | AustNasuHG_c1019220 | 3300000089 | Bacteria | 2245 |
| 166 | JGI24695J34938_10002411 | 3300002450 | Bacteria | 14338 |
| 167 | JGI24695J34938_10013235 | 3300002450 | Bacteria | 4340 |
| 168 | JGI24695J34938_10018018 | 3300002450 | Bacteria | 3545 |
| 169 | JGI24695J34938_10032691 | 3300002450 | Bacteria | 2401 |
| 170 | JGI24695J34938_10046969 | 3300002450 | Bacteria | 1909 |
| 171 | Ga0072940_1007865 | 3300005200 | Bacteria | 3349 |
| 172 | Ga0466705_074637 | 3300042612 | Bacteria | 4041 |
| 173 | Ga0466692_106369 | 3300042591 | Bacteria | 2695 |
| 174 | Ga0466691_103245 | 3300042593 | Bacteria | 3051 |
| 175 | Ga0466696_415110 | 3300042596 | Bacteria | 13163 |
| 176 | Ga0466696_469261 | 3300042596 | Bacteria | 2058 |
| 177 | Ga0466699_148875 | 3300042597 | Bacteria | 1381 |
| 178 | Ga0466699_210310 | 3300042597 | Bacteria | 12653 |
| 179 | Ga0466699_247036 | 3300042597 | Bacteria | 2106 |
| 180 | Ga0466699_442898 | 3300042597 | Bacteria | 15300 |
| 181 | Ga0466712_300559 | 3300042614 | Bacteria | 1282 |
| 182 | Ga0466715_239778 | 3300042616 | Bacteria | 13090 |
| 183 | Ga0466715_381295 | 3300042616 | Bacteria | 3245 |
| 184 | Ga0466718_048454 | 3300042617 | Bacteria | 4128 |
| 185 | Ga0466718_107405 | 3300042617 | Bacteria | 7700 |
| 186 | Ga0466718_110798 | 3300042617 | Bacteria | 5356 |
| 187 | Ga0466726_013181 | 3300042619 | Bacteria | 3298 |
| 188 | Ga0123355_10734042 | 3300009826 | Bacteria | 1122 |
| 189 | Ga0123353_10344400 | 3300010167 | Bacteria | 2250 |
| 190 | Ga0466719_292931 | 3300042606 | Archaea | 5257 |
| 191 | Ga0466720_008269 | 3300042607 | Bacteria | 14083 |
| 192 | Ga0466722_234230 | 3300042609 | Bacteria | 6630 |
| 193 | Ga0466698_062299 | 3300042610 | Bacteria | 1118 |
| 194 | Ga0466731_306864 | 3300042622 | Bacteria | 2325 |
| 195 | Ga0466703_150282 | 3300042636 | Bacteria | 8184 |
| 196 | Ga0466709_015866 | 3300042648 | Bacteria | 5259 |
| 197 | AustNasuHG_c1030038 | 3300000089 | Bacteria | 1575 |
| 198 | JGI24698J34947_10056046 | 3300002449 | Unclassified | 1961 |
| 199 | JGI24695J34938_10006874 | 3300002450 | Bacteria | 6753 |
| 200 | JGI24695J34938_10019645 | 3300002450 | Bacteria | 3341 |
| 201 | JGI24702J35022_10005549 | 3300002462 | Bacteria | 7358 |
| 202 | Ga0264413_101148 | 3300024493 | Bacteria | 13602 |
| 203 | Ga0466692_061899 | 3300042591 | Bacteria | 1523 |
| 204 | Ga0466696_145351 | 3300042596 | Bacteria | 4888 |
| 205 | Ga0466699_299975 | 3300042597 | Bacteria | 5184 |
| 206 | Ga0466712_120956 | 3300042614 | Bacteria | 1755 |
| 207 | Ga0466712_192409 | 3300042614 | Bacteria | 2069 |
| 208 | Ga0466715_021631 | 3300042616 | Bacteria | 5458 |
| 209 | Ga0466715_323231 | 3300042616 | Bacteria | 3372 |
| 210 | Ga0466726_173534 | 3300042619 | Bacteria | 3195 |
| 211 | Ga0466726_312367 | 3300042619 | Bacteria | 4321 |
| 212 | Ga0123355_10141232 | 3300009826 | Bacteria | 3684 |
| 213 | Ga0466700_164178 | 3300042600 | Bacteria | 1835 |
| 214 | Ga0466707_289832 | 3300042601 | Bacteria | 4290 |
| 215 | Ga0466717_132138 | 3300042604 | Bacteria | 1277 |
| 216 | Ga0466720_012947 | 3300042607 | Unclassified | 4125 |
| 217 | Ga0466722_266552 | 3300042609 | Bacteria | 3077 |
| 218 | Ga0466731_014072 | 3300042622 | Bacteria | 1113 |
| 219 | Ga0466703_039154 | 3300042636 | Bacteria | 3555 |
| 220 | Ga0466704_299159 | 3300042643 | Bacteria | 58999 |
| 221 | JGI24698J34947_10001305 | 3300002449 | Bacteria | 13082 |
| 222 | JGI24698J34947_10028288 | 3300002449 | Bacteria | 2968 |
| 223 | JGI24698J34947_10032391 | 3300002449 | Unclassified | 2745 |
| 224 | Ga0074263_103561 | 3300005485 | Bacteria | 1055 |
| 225 | Ga0074263_110925 | 3300005485 | Bacteria | 1597 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00528 | BPD_transp_1 | Binding-protein-dependent transport system inner membrane component | 126 | 290 | 0.9 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.