Protein Family IF00666

Metagenome Isolate
186 Members
52 Samples
169 Scaffolds
237.59 Avg Length

🧬 Representative Sequence

ID
3300002450|JGI24695J34938_10015708|JGI24695J34938_100157085
Length
265 aa
Sequence
MPHETHTVKTSPSQINEEGLPVHIGIIMDGNGRWAKKRGLVRTQGHLEGLKTAKKIVKAASDLGVKYLTLYAFSTENWTRAKEEVGFIMSLIRQFLHSELDFSRQDQIRTRFAGDLSGLPPDIQKEIIGSITDTADFKGMQVVLAINYGGRDEILRAVKKFYSQNAGKSLNDLNEGDITAFLDNPDIPDPDLIIRSAGDCRISNFLLWESAYSELFISDRLWPDWDKADLLNAISDFQKRERRFGGIKTKKTASAPSEHDEKNY*

📊 Sample Types

Isolate 9.1%
Metagenome 90.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 50.0%
Unclassified 32.0%
Kalotermitidae 8.0%
Rhinotermitidae 6.0%
Termopsidae 4.0%

🌳 Taxonomy

Archaea 0
Bacteria 179
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
2 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
3 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
4 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
5 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
6 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
7 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
8 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
9 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
10 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
11 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
12 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
13 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
14 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
15 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
16 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
17 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
18 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
19 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
20 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
21 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
22 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
23 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
24 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
25 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
26 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
27 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
28 2740892545 Fibrobacteria bacterium GUT31 IN01_31 Isolate Unclassified
29 2781125682 Treponema sp. Lab288P1bin107 Isolate Unclassified
30 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
31 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
32 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
33 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
34 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
35 2781125641 Treponema sp. Co191P1bin27 Isolate Unclassified
36 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
37 2228664003 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA Metagenome Termitidae
38 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
39 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
40 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
41 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
42 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
43 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
44 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
45 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
46 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
47 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
48 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
49 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
50 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
51 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
52 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466720_078453 3300042607 Bacteria 15244
2 Ga0466698_026374 3300042610 Bacteria 12803
3 2230954317 2228664003 Bacteria 3108
4 AustNasuHG_c1047614 3300000089 Bacteria 953
5 JGI24698J34947_10000691 3300002449 Bacteria 16465
6 JGI24698J34947_10003911 3300002449 Bacteria 8098
7 JGI24698J34947_10078317 3300002449 Bacteria 1560
8 JGI24695J34938_10000014 3300002450 Bacteria 120713
9 JGI24695J34938_10000043 3300002450 Bacteria 94696
10 JGI24695J34938_10063482 3300002450 Bacteria 1566
11 Ga0072940_1035794 3300005200 Unclassified 16352
12 Ga0072941_1003865 3300005201 Bacteria 32964
13 Ga0072941_1045779 3300005201 Bacteria 4335
14 Ga0074263_118266 3300005485 Unclassified 2977
15 Ga0466734_104739 3300042623 Bacteria 1531
16 Ga0466702_106066 3300042635 Bacteria 27037
17 Ga0264413_107374 3300024493 Bacteria 10404
18 Ga0466712_076443 3300042614 Bacteria 7433
19 Ga0466712_195101 3300042614 Bacteria 17668
20 Ga0466712_209554 3300042614 Bacteria 30568
21 Ga0466718_020506 3300042617 Bacteria 1509
22 Ga0466718_169396 3300042617 Unclassified 1635
23 Ga0466726_322505 3300042619 Bacteria 2448
24 Ga0466732_284091 3300042656 Bacteria 1082
25 Ga0123356_10013265 3300010049 Bacteria 7964
26 Ga0123356_10018720 3300010049 Bacteria 6573
27 Ga0123356_10082476 3300010049 Bacteria 3044
28 Ga0466719_473072 3300042606 Bacteria 58828
29 Ga0466720_013259 3300042607 Bacteria 4267
30 AustNasuHG_c1015783 3300000089 Bacteria 2541
31 JGI24698J34947_10000094 3300002449 Bacteria 30023
32 JGI24698J34947_10008877 3300002449 Bacteria 5517
33 JGI24698J34947_10013056 3300002449 Bacteria 4537
34 JGI24695J34938_10002852 3300002450 Bacteria 12593
35 JGI24695J34938_10011879 3300002450 Bacteria 4655
36 JGI24695J34938_10020741 3300002450 Bacteria 3228
37 Ga0072940_1046007 3300005200 Unclassified 2811
38 Ga0072941_1009282 3300005201 Bacteria 26178
39 Ga0072941_1099765 3300005201 Bacteria 3362
40 Ga0466729_274270 3300042621 Bacteria 1334
41 Ga0466731_236514 3300042622 Bacteria 3522
42 Ga0466704_309373 3300042643 Bacteria 19706
43 Ga0415639_023853 3300038395 Bacteria 1634
44 Ga0466699_350752 3300042597 Bacteria 1162
45 Ga0466712_066353 3300042614 Bacteria 17178
46 Ga0466712_153430 3300042614 Bacteria 1962
47 Ga0466712_245594 3300042614 Bacteria 24408
48 Ga0466718_031791 3300042617 Bacteria 1405
49 Ga0123356_10048902 3300010049 Bacteria 3936
50 Ga0466700_205862 3300042600 Bacteria 4745
51 Ga0466720_032731 3300042607 Bacteria 15887
52 Ga0466720_220267 3300042607 Bacteria 4338
53 AustNasuHG_c1005467 3300000089 Bacteria 4542
54 JGI24695J34938_10000108 3300002450 Bacteria 73543
55 JGI24695J34938_10014752 3300002450 Bacteria 4034
56 JGI24695J34938_10094753 3300002450 Bacteria 1223
57 JGI24702J35022_10011464 3300002462 Bacteria 4939
58 Ga0072941_1024730 3300005201 Bacteria 9744
59 Ga0466731_349309 3300042622 Bacteria 1226
60 Ga0466702_212593 3300042635 Bacteria 3099
61 Ga0466693_075896 3300042592 Bacteria 53125
62 Ga0466694_283098 3300042594 Bacteria 3876
63 Ga0466699_245187 3300042597 Bacteria 1456
64 Ga0466718_006244 3300042617 Bacteria 4102
65 Ga0123356_10262990 3300010049 Bacteria 1810
66 Ga0466720_020925 3300042607 Bacteria 3106
67 Ga0466720_151061 3300042607 Bacteria 3106
68 Ga0466720_216465 3300042607 Bacteria 5260
69 JGI24698J34947_10000681 3300002449 Bacteria 16593
70 JGI24698J34947_10003009 3300002449 Bacteria 9134
71 JGI24698J34947_10016482 3300002449 Bacteria 4011
72 JGI24695J34938_10000101 3300002450 Bacteria 74732
73 JGI24695J34938_10001346 3300002450 Bacteria 21222
74 JGI24695J34938_10003496 3300002450 Bacteria 10919
75 JGI24695J34938_10007106 3300002450 Bacteria 6617
76 JGI24695J34938_10012957 3300002450 Bacteria 4396
77 JGI24695J34938_10013768 3300002450 Bacteria 4232
78 JGI24695J34938_10027549 3300002450 Bacteria 2685
79 JGI24695J34938_10067803 3300002450 Bacteria 1500
80 Ga0466731_335618 3300042622 Bacteria 3145
81 Ga0466702_064215 3300042635 Bacteria 1221
82 Ga0466702_069960 3300042635 Bacteria 24936
83 Ga0264413_100787 3300024493 Bacteria 17408
84 Ga0466693_272064 3300042592 Bacteria 25117
85 Ga0466694_048357 3300042594 Bacteria 1162
86 Ga0466712_232783 3300042614 Bacteria 15480
87 Ga0466732_188439 3300042656 Bacteria 1019
88 Ga0123356_10000525 3300010049 Bacteria 42550
89 Ga0123356_10011088 3300010049 Bacteria 8802
90 Ga0123356_10050807 3300010049 Bacteria 3857
91 Ga0466720_047963 3300042607 Bacteria 10474
92 AustNasuHG_c1028406 3300000089 Bacteria 1672
93 JGI24698J34947_10091764 3300002449 Bacteria 1391
94 JGI24695J34938_10003770 3300002450 Bacteria 10337
95 JGI24695J34938_10014828 3300002450 Bacteria 4020
96 JGI24695J34938_10023731 3300002450 Unclassified 2953
97 Ga0072941_1024671 3300005201 Bacteria 4180
98 Ga0074263_114302 3300005485 Bacteria 6025
99 Ga0074263_115403 3300005485 Bacteria 4125
100 Ga0466702_191272 3300042635 Bacteria 19326
101 Ga0466694_165576 3300042594 Bacteria 1070
102 Ga0466694_201600 3300042594 Bacteria 8200
103 Ga0466694_343863 3300042594 Bacteria 2704
104 Ga0466712_084706 3300042614 Bacteria 14068
105 Ga0466712_096579 3300042614 Bacteria 1858
106 Ga0466718_005106 3300042617 Bacteria 8688
107 Ga0123356_10000052 3300010049 Bacteria 124725
108 Ga0123356_11268686 3300010049 Bacteria 901
109 Ga0466720_189054 3300042607 Bacteria 7381
110 Ga0466721_002118 3300042608 Bacteria 35712
111 Ga0466722_016207 3300042609 Bacteria 3425
112 Ga0466722_033280 3300042609 Bacteria 4644
113 Ga0466722_164439 3300042609 Bacteria 25198
114 AustNasuHG_c1006399 3300000089 Bacteria 4204
115 JGI24695J34938_10002961 3300002450 Bacteria 12256
116 JGI24695J34938_10005692 3300002450 Bacteria 7692
117 JGI24695J34938_10015708 3300002450 Bacteria 3874
118 JGI24695J34938_10023665 3300002450 Bacteria 2958
119 JGI24700J35501_10930383 3300002508 Bacteria 13512
120 Ga0072940_1014827 3300005200 Unclassified 1108
121 Ga0072940_1211740 3300005200 Bacteria 3544
122 Ga0072941_1023790 3300005201 Bacteria 16457
123 Ga0466731_033348 3300042622 Bacteria 7824
124 Ga0466731_168370 3300042622 Bacteria 1464
125 Ga0466731_314152 3300042622 Bacteria 2165
126 Ga0466735_004047 3300042624 Bacteria 1190
127 Ga0466708_063506 3300042652 Bacteria 7049
128 Ga0264413_101988 3300024493 Bacteria 12020
129 Ga0264413_117748 3300024493 Bacteria 13996
130 Ga0415639_044136 3300038395 Bacteria 1670
131 Ga0415639_084672 3300038395 Unclassified 2686
132 Ga0466699_021544 3300042597 Bacteria 70828
133 Ga0466712_250011 3300042614 Bacteria 13067
134 Ga0466711_036291 3300042615 Bacteria 46909
135 Ga0466718_037628 3300042617 Bacteria 6288
136 Ga0466718_057027 3300042617 Bacteria 2400
137 Ga0466718_148910 3300042617 Bacteria 34374
138 Ga0123355_10071765 3300009826 Bacteria 5557
139 Ga0466720_090640 3300042607 Bacteria 13684
140 Ga0466721_385880 3300042608 Bacteria 1343
141 Ga0466722_057493 3300042609 Bacteria 12192
142 AustNasuHG_c1002336 3300000089 Bacteria 6856
143 AustNasuHG_c1042450 3300000089 Bacteria 1082
144 JGI24695J34938_10022443 3300002450 Bacteria 3065
145 Ga0072941_1006471 3300005201 Bacteria 6444
146 Ga0415639_012739 3300038395 Bacteria 3780
147 Ga0466694_006279 3300042594 Bacteria 29816
148 Ga0466694_055441 3300042594 Bacteria 3691
149 Ga0466694_153808 3300042594 Bacteria 1054
150 Ga0466694_232930 3300042594 Bacteria 11790
151 Ga0466712_076106 3300042614 Bacteria 3700
152 Ga0466732_069398 3300042656 Bacteria 4943
153 Ga0123356_10046560 3300010049 Bacteria 4036
154 Ga0123353_10068960 3300010167 Bacteria 5680
155 Ga0123353_10121055 3300010167 Bacteria 4208
156 Ga0466720_194284 3300042607 Bacteria 1608
157 AustNasuHG_c1000392 3300000089 Bacteria 15204
158 JGI24698J34947_10068512 3300002449 Bacteria 1716
159 JGI24695J34938_10000074 3300002450 Bacteria 84540
160 JGI24695J34938_10001301 3300002450 Bacteria 21804
161 JGI24695J34938_10001483 3300002450 Bacteria 19815
162 Ga0072941_1034147 3300005201 Bacteria 9094
163 Ga0072941_1074770 3300005201 Bacteria 6066
164 Ga0415639_021263 3300038395 Bacteria 30338
165 Ga0466692_180904 3300042591 Bacteria 1967
166 Ga0466694_134541 3300042594 Bacteria 16565
167 Ga0466694_138542 3300042594 Bacteria 1058
168 Ga0466694_386038 3300042594 Bacteria 5704
169 Ga0466712_243936 3300042614 Bacteria 12276

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01255 Prenyltransf Putative undecaprenyl diphosphate synthase 27 245 0.96

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01255 GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.