Protein Family IF00651
Metagenome
Isolate
129
Members
43
Samples
121
Scaffolds
320.52
Avg Length
Representative Sequence
- ID
- 3300002450|JGI24695J34938_10011538|JGI24695J34938_100115382
- Length
- 361 aa
- Sequence
- MAGIPGTKRDFIMDAPCSRTSPVLLPIGGIVYQSVPDFEGHLEKELSLFCEEDSSSGKDSGFERWGNLFHLKTNVNISPNESPDLPPVFWHLNAWLDPVKITFNSINEAAKALREIQRNWSPVLFTHYRRGNLIASKLPSVSTKKRIFPWLSPLSPMGAWTLLDERTMLASARCSSPFPAGLIEFEEDKEGPPSRAYLKLWESFARLRRLPEKGEKCLDAGASPGAWTWALKQLGAEVIAVDRAPLEAKIAAMPGVSFIQGDAFALKPEDXGRIDWLFCDVICYPHRLFQWIEKWLSSGLCQNFVCTIKMQGTVEXGVDFDVPRRFAAIPGSFVVHLCHNXHELTWICYNYSEYAQRTLI*
Sample Types
Isolate
6.2%
Metagenome
93.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
33.3%
Termitidae
28.6%
Unclassified
21.4%
Rhinotermitidae
9.5%
Termopsidae
7.1%
Taxonomy
Archaea
0
Bacteria
128
Eukaryota
0
Viruses
0
Unclassified
1
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 6 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 7 | 2781125685 | Treponema sp. Lab288P1bin13 | Isolate | Unclassified |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 12 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 13 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 14 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 15 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 16 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 17 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 18 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 19 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 20 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 21 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 22 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 23 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 24 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 25 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 26 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 27 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 28 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 29 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 30 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 31 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 32 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 33 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 34 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 35 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 36 | 2781125686 | Treponema sp. Lab288P4bin22 | Isolate | Unclassified |
| 37 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 38 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 39 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 40 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 41 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 42 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 43 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_153442 | 3300042612 | Bacteria | 1892 |
| 2 | Ga0466731_312819 | 3300042622 | Bacteria | 1794 |
| 3 | Ga0466727_008442 | 3300042655 | Bacteria | 5327 |
| 4 | Ga0466707_260957 | 3300042601 | Bacteria | 1374 |
| 5 | Ga0466716_372708 | 3300042605 | Bacteria | 18312 |
| 6 | Ga0466719_113197 | 3300042606 | Bacteria | 36499 |
| 7 | Ga0466722_012472 | 3300042609 | Bacteria | 8724 |
| 8 | Ga0466722_091622 | 3300042609 | Bacteria | 12192 |
| 9 | Ga0264413_103330 | 3300024493 | Bacteria | 6763 |
| 10 | Ga0466690_138520 | 3300042590 | Unclassified | 3822 |
| 11 | Ga0466696_053521 | 3300042596 | Bacteria | 2043 |
| 12 | Ga0123353_10058461 | 3300010167 | Bacteria | 6178 |
| 13 | Ga0466711_021838 | 3300042615 | Bacteria | 4280 |
| 14 | Ga0466726_333135 | 3300042619 | Bacteria | 4923 |
| 15 | Ga0466708_447205 | 3300042652 | Bacteria | 19646 |
| 16 | Ga0466707_385222 | 3300042601 | Bacteria | 2275 |
| 17 | Ga0466719_363855 | 3300042606 | Bacteria | 4568 |
| 18 | Ga0466720_090368 | 3300042607 | Bacteria | 39301 |
| 19 | Ga0466690_030572 | 3300042590 | Bacteria | 18022 |
| 20 | Ga0466691_193609 | 3300042593 | Bacteria | 3491 |
| 21 | Ga0466694_052077 | 3300042594 | Bacteria | 1228 |
| 22 | Ga0466696_105886 | 3300042596 | Bacteria | 4598 |
| 23 | Ga0123355_10400797 | 3300009826 | Bacteria | 1770 |
| 24 | Ga0123354_10122400 | 3300010882 | Bacteria | 3349 |
| 25 | Ga0123354_10238756 | 3300010882 | Bacteria | 1876 |
| 26 | Ga0466711_259608 | 3300042615 | Bacteria | 24557 |
| 27 | Ga0466715_132349 | 3300042616 | Bacteria | 19961 |
| 28 | Ga0466723_057870 | 3300042618 | Bacteria | 12370 |
| 29 | Ga0466723_217696 | 3300042618 | Bacteria | 3006 |
| 30 | Ga0466729_223056 | 3300042621 | Bacteria | 1216 |
| 31 | Ga0466735_042760 | 3300042624 | Bacteria | 4397 |
| 32 | Ga0466735_192282 | 3300042624 | Bacteria | 1475 |
| 33 | Ga0466703_077422 | 3300042636 | Bacteria | 3603 |
| 34 | Ga0466703_100612 | 3300042636 | Bacteria | 66039 |
| 35 | Ga0466709_231861 | 3300042648 | Bacteria | 2240 |
| 36 | Ga0466708_217030 | 3300042652 | Bacteria | 11991 |
| 37 | Ga0466707_198131 | 3300042601 | Bacteria | 6635 |
| 38 | Ga0466691_103961 | 3300042593 | Bacteria | 5820 |
| 39 | Ga0466696_327174 | 3300042596 | Bacteria | 10098 |
| 40 | Ga0123357_10005186 | 3300009784 | Bacteria | 15551 |
| 41 | Ga0466711_316023 | 3300042615 | Bacteria | 1915 |
| 42 | Ga0466715_088291 | 3300042616 | Bacteria | 3702 |
| 43 | Ga0466723_132421 | 3300042618 | Bacteria | 16358 |
| 44 | Ga0466703_097945 | 3300042636 | Bacteria | 6152 |
| 45 | Ga0466719_510389 | 3300042606 | Bacteria | 3486 |
| 46 | Ga0466720_045032 | 3300042607 | Bacteria | 5188 |
| 47 | Ga0466722_090527 | 3300042609 | Bacteria | 15546 |
| 48 | Ga0456237_0002545 | 3300041968 | Bacteria | 2947 |
| 49 | Ga0466692_138530 | 3300042591 | Bacteria | 3779 |
| 50 | Ga0466691_178884 | 3300042593 | Bacteria | 2641 |
| 51 | JGI24695J34938_10023664 | 3300002450 | Bacteria | 2958 |
| 52 | Ga0466715_375885 | 3300042616 | Bacteria | 1722 |
| 53 | Ga0466715_536283 | 3300042616 | Bacteria | 1630 |
| 54 | Ga0466718_097855 | 3300042617 | Bacteria | 3138 |
| 55 | Ga0466723_272863 | 3300042618 | Bacteria | 9785 |
| 56 | Ga0466726_466552 | 3300042619 | Bacteria | 1887 |
| 57 | Ga0466728_012576 | 3300042620 | Bacteria | 10347 |
| 58 | Ga0466705_085597 | 3300042612 | Bacteria | 5583 |
| 59 | Ga0466735_213142 | 3300042624 | Bacteria | 1213 |
| 60 | Ga0466703_274593 | 3300042636 | Bacteria | 5197 |
| 61 | Ga0466704_218768 | 3300042643 | Bacteria | 93221 |
| 62 | Ga0466719_242816 | 3300042606 | Bacteria | 17675 |
| 63 | Ga0466719_427140 | 3300042606 | Bacteria | 2712 |
| 64 | Ga0466720_025777 | 3300042607 | Bacteria | 2709 |
| 65 | Ga0466720_030990 | 3300042607 | Bacteria | 12575 |
| 66 | Ga0466720_105228 | 3300042607 | Bacteria | 20857 |
| 67 | Ga0466722_123073 | 3300042609 | Bacteria | 2024 |
| 68 | Ga0264413_109496 | 3300024493 | Bacteria | 3926 |
| 69 | Ga0466693_126386 | 3300042592 | Bacteria | 4790 |
| 70 | Ga0466691_061952 | 3300042593 | Bacteria | 11060 |
| 71 | Ga0466691_099473 | 3300042593 | Bacteria | 15204 |
| 72 | Ga0466696_286675 | 3300042596 | Bacteria | 1920 |
| 73 | Ga0123353_10337857 | 3300010167 | Bacteria | 2276 |
| 74 | Ga0123354_10017269 | 3300010882 | Bacteria | 11307 |
| 75 | Ga0072940_1017262 | 3300005200 | Bacteria | 7416 |
| 76 | Ga0466718_046207 | 3300042617 | Bacteria | 64941 |
| 77 | Ga0466726_191086 | 3300042619 | Bacteria | 2052 |
| 78 | Ga0466726_338713 | 3300042619 | Bacteria | 2446 |
| 79 | Ga0466726_356834 | 3300042619 | Bacteria | 2930 |
| 80 | Ga0466726_385697 | 3300042619 | Bacteria | 2361 |
| 81 | Ga0466726_389216 | 3300042619 | Bacteria | 2599 |
| 82 | Ga0466728_045093 | 3300042620 | Bacteria | 13388 |
| 83 | Ga0466728_463033 | 3300042620 | Bacteria | 11828 |
| 84 | Ga0466705_357745 | 3300042612 | Bacteria | 1801 |
| 85 | Ga0466727_212494 | 3300042655 | Bacteria | 13739 |
| 86 | Ga0466719_031347 | 3300042606 | Bacteria | 1495 |
| 87 | Ga0466720_026527 | 3300042607 | Bacteria | 13173 |
| 88 | Ga0466720_189402 | 3300042607 | Bacteria | 39752 |
| 89 | Ga0466699_403514 | 3300042597 | Bacteria | 3091 |
| 90 | Ga0123353_10012960 | 3300010167 | Bacteria | 11907 |
| 91 | JGI24695J34938_10011538 | 3300002450 | Bacteria | 4752 |
| 92 | Ga0466705_419196 | 3300042612 | Bacteria | 9628 |
| 93 | Ga0466726_251276 | 3300042619 | Bacteria | 1227 |
| 94 | Ga0466735_011547 | 3300042624 | Bacteria | 2906 |
| 95 | Ga0466703_015344 | 3300042636 | Bacteria | 1510 |
| 96 | Ga0466704_154862 | 3300042643 | Bacteria | 4819 |
| 97 | Ga0466720_088854 | 3300042607 | Bacteria | 7831 |
| 98 | Ga0466722_096112 | 3300042609 | Bacteria | 9128 |
| 99 | Ga0466694_094414 | 3300042594 | Bacteria | 3108 |
| 100 | Ga0466696_014563 | 3300042596 | Bacteria | 16705 |
| 101 | Ga0123353_10042998 | 3300010167 | Bacteria | 7153 |
| 102 | Ga0123353_10096507 | 3300010167 | Bacteria | 4764 |
| 103 | Ga0466715_219956 | 3300042616 | Bacteria | 4940 |
| 104 | Ga0466726_469655 | 3300042619 | Bacteria | 1882 |
| 105 | Ga0466704_238045 | 3300042643 | Bacteria | 16790 |
| 106 | Ga0466727_207003 | 3300042655 | Bacteria | 1539 |
| 107 | Ga0466719_098141 | 3300042606 | Bacteria | 13438 |
| 108 | Ga0466720_025783 | 3300042607 | Bacteria | 15217 |
| 109 | Ga0466720_114556 | 3300042607 | Bacteria | 7321 |
| 110 | Ga0466720_210761 | 3300042607 | Bacteria | 15962 |
| 111 | Ga0466722_038093 | 3300042609 | Bacteria | 15498 |
| 112 | Ga0466722_113253 | 3300042609 | Bacteria | 2500 |
| 113 | Ga0264413_100256 | 3300024493 | Bacteria | 6128 |
| 114 | Ga0264413_100697 | 3300024493 | Bacteria | 9944 |
| 115 | Ga0466690_152017 | 3300042590 | Bacteria | 1446 |
| 116 | Ga0466692_129928 | 3300042591 | Bacteria | 1622 |
| 117 | Ga0123357_10221204 | 3300009784 | Bacteria | 2100 |
| 118 | Ga0466723_227236 | 3300042618 | Bacteria | 5030 |
| 119 | Ga0466726_090335 | 3300042619 | Bacteria | 2337 |
| 120 | Ga0466728_167163 | 3300042620 | Bacteria | 3036 |
| 121 | Ga0466728_236547 | 3300042620 | Bacteria | 2319 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01728 | FtsJ | FtsJ-like methyltransferase | 194 | 282 | 0.84 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.