Protein Family IF00635
Metagenome
Metatranscriptome
Isolate
143
Members
57
Samples
128
Scaffolds
573.34
Avg Length
Representative Sequence
- ID
- 3300002450|JGI24695J34938_10006488|JGI24695J34938_100064886
- Length
- 673 aa
- Sequence
- MMRKRYRFAIILAVLAVCFVFLWPSLRWHFFTPMEQQARAMQSREQLRNSAMLRAESDFQRLLEGPAPTEAFLEEALAQAREEAVGLQGLADLARMDGWGLLAGPLAAALPRLEELAGEEPGASAASNLQRILEMAREGGAAADGAAFAAXXVXXXEXLQARRLNRDNRRPNPARWDARAALAAFPTPLAVRDAIENRYRDDVFSLRSMQRRAVQLGLDLSGGLSIVLQADMDALQERLDRPLTDADRDDAMERALIDLNSRIDQFGLTEPVIRRQGPDQIYVEIPGSADPERINDIIMGRGSLTFHIVDEDATAAFNAFYGAHGHFATFDGLGNLRDPMLVPPDVVIRGVYEQDRFGLNVPVYWDRDRGLRRYVAVRREVGLDGYHIRSALVERDQFGRPEVIFNMTGEGGELFWNLTSANVQRPMAIVLDDRVRSYPTIQTAIRDRVRLTGFGMDEANGIAMMLRTAGLPVTLEVASQQSIGASMGEDTIRQGLFALLGGVAMVLVFMLLFYKSAGINAVVAQLLNFYIMFSVLSAFSFTLTLPSIAGFILTIGMATDANVIVFERIKEELRLGKSRKAAIEIGFDKAFWAVMDSNVTTFIAALFLAQLGSGPIQGFAVALSVGVFSSVFTALFVSRLIFDFGTEVLRSRTIPITWAKQRVAGAAVGGTR*
Sample Types
Isolate
10.5%
Metagenome
88.8%
MAG
0.0%
Metatranscriptome
0.7%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
35.7%
Unclassified
28.6%
Kalotermitidae
25.0%
Rhinotermitidae
3.6%
Termopsidae
3.6%
Hodotermitidae
1.8%
Blaberidae
1.8%
Taxonomy
Archaea
0
Bacteria
136
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 2 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 3 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 4 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 5 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 6 | 2820023741 | Unclassified Spirochaetes Lab288P3bin165 | Isolate | Unclassified |
| 7 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 8 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 9 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 10 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 11 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 12 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 13 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 14 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 15 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 16 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 17 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 18 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 19 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 20 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 21 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 22 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 23 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 24 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 25 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 26 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 27 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 28 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 29 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 30 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 31 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 32 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 33 | 3300021190 | Termite gut microbial communities from nest - French Guiana - 1_3 mRNA 1_3 mRNA SA | Metatranscriptome | Termitidae |
| 34 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 35 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 36 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 37 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 38 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 39 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 40 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 41 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 42 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 43 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 44 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 45 | 2819990093 | Unclassified Spirochaetes Cu122P1bin9 | Isolate | Unclassified |
| 46 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 47 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 48 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 49 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 50 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 51 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 52 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 53 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 54 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 55 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 56 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 57 | 2820027804 | Unclassified Spirochaetes Lab288P1bin105 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0415639_105323 | 3300038395 | Bacteria | 7975 |
| 2 | Ga0415639_122067 | 3300038395 | Bacteria | 3916 |
| 3 | Ga0466712_023524 | 3300042614 | Bacteria | 21459 |
| 4 | Ga0466715_096782 | 3300042616 | Bacteria | 4172 |
| 5 | Ga0466715_181913 | 3300042616 | Bacteria | 3537 |
| 6 | Ga0466723_082665 | 3300042618 | Bacteria | 17262 |
| 7 | Ga0466726_207342 | 3300042619 | Bacteria | 9281 |
| 8 | Ga0466720_082406 | 3300042607 | Bacteria | 20211 |
| 9 | Ga0466720_086464 | 3300042607 | Bacteria | 3795 |
| 10 | Ga0466721_040497 | 3300042608 | Bacteria | 19632 |
| 11 | Ga0466702_023988 | 3300042635 | Bacteria | 3071 |
| 12 | JGI24698J34947_10020487 | 3300002449 | Unclassified | 3560 |
| 13 | JGI24695J34938_10006488 | 3300002450 | Bacteria | 7006 |
| 14 | JGI24695J34938_10023889 | 3300002450 | Bacteria | 2941 |
| 15 | Ga0466732_406740 | 3300042656 | Bacteria | 29581 |
| 16 | Ga0466733_077577 | 3300042659 | Bacteria | 14399 |
| 17 | Ga0466733_185067 | 3300042659 | Bacteria | 39045 |
| 18 | Ga0466690_326911 | 3300042590 | Bacteria | 3076 |
| 19 | Ga0466712_187162 | 3300042614 | Bacteria | 11305 |
| 20 | Ga0466715_125046 | 3300042616 | Bacteria | 8504 |
| 21 | Ga0466718_002149 | 3300042617 | Bacteria | 22367 |
| 22 | Ga0466728_198021 | 3300042620 | Bacteria | 5208 |
| 23 | Ga0466707_235445 | 3300042601 | Bacteria | 3201 |
| 24 | Ga0466716_002220 | 3300042605 | Bacteria | 3468 |
| 25 | Ga0466702_063384 | 3300042635 | Bacteria | 12465 |
| 26 | Ga0466708_139336 | 3300042652 | Bacteria | 48639 |
| 27 | JGI24698J34947_10000800 | 3300002449 | Bacteria | 15625 |
| 28 | JGI24695J34938_10001894 | 3300002450 | Bacteria | 16947 |
| 29 | JGI24695J34938_10032902 | 3300002450 | Bacteria | 2391 |
| 30 | Ga0123356_10001795 | 3300010049 | Bacteria | 23388 |
| 31 | Ga0123356_10003270 | 3300010049 | Bacteria | 17019 |
| 32 | Ga0466732_317009 | 3300042656 | Bacteria | 7996 |
| 33 | Ga0466705_040381 | 3300042612 | Bacteria | 16401 |
| 34 | Ga0466726_136220 | 3300042619 | Bacteria | 6399 |
| 35 | Ga0466726_396881 | 3300042619 | Bacteria | 10428 |
| 36 | Ga0466707_132070 | 3300042601 | Bacteria | 5212 |
| 37 | Ga0466720_038676 | 3300042607 | Bacteria | 20239 |
| 38 | Ga0466722_009808 | 3300042609 | Bacteria | 7327 |
| 39 | Ga0466703_112152 | 3300042636 | Bacteria | 9417 |
| 40 | Ga0466727_342607 | 3300042655 | Bacteria | 7416 |
| 41 | AustNasuHG_c1001085 | 3300000089 | Bacteria | 9765 |
| 42 | JGI24695J34938_10000080 | 3300002450 | Bacteria | 82616 |
| 43 | JGI24702J35022_10000918 | 3300002462 | Bacteria | 18353 |
| 44 | Ga0068305_10009630 | 3300005083 | Bacteria | 8838 |
| 45 | Ga0466733_149102 | 3300042659 | Bacteria | 23474 |
| 46 | Ga0466692_012972 | 3300042591 | Bacteria | 16690 |
| 47 | Ga0466705_298927 | 3300042612 | Bacteria | 1891 |
| 48 | Ga0466712_211647 | 3300042614 | Unclassified | 14390 |
| 49 | Ga0466715_559985 | 3300042616 | Bacteria | 52926 |
| 50 | Ga0466716_016485 | 3300042605 | Bacteria | 14263 |
| 51 | Ga0466720_036535 | 3300042607 | Bacteria | 14362 |
| 52 | Ga0466702_420796 | 3300042635 | Bacteria | 21022 |
| 53 | Ga0466703_405388 | 3300042636 | Bacteria | 4504 |
| 54 | Ga0466708_220067 | 3300042652 | Bacteria | 8647 |
| 55 | Ga0466708_278401 | 3300042652 | Bacteria | 6399 |
| 56 | Ga0466727_169724 | 3300042655 | Bacteria | 3613 |
| 57 | JGI24698J34947_10001700 | 3300002449 | Bacteria | 11766 |
| 58 | JGI24695J34938_10001037 | 3300002450 | Bacteria | 25193 |
| 59 | JGI24695J34938_10002708 | 3300002450 | Bacteria | 13124 |
| 60 | JGI24695J34938_10002933 | 3300002450 | Bacteria | 12346 |
| 61 | JGI24702J35022_10003896 | 3300002462 | Bacteria | 8949 |
| 62 | Ga0123355_10001318 | 3300009826 | Bacteria | 34590 |
| 63 | Ga0123356_10044796 | 3300010049 | Bacteria | 4118 |
| 64 | Ga0466691_123216 | 3300042593 | Bacteria | 3408 |
| 65 | Ga0466705_094903 | 3300042612 | Bacteria | 13125 |
| 66 | Ga0466711_294107 | 3300042615 | Bacteria | 20081 |
| 67 | Ga0466715_378175 | 3300042616 | Bacteria | 8771 |
| 68 | Ga0466718_048448 | 3300042617 | Bacteria | 5710 |
| 69 | Ga0466726_235190 | 3300042619 | Bacteria | 2619 |
| 70 | Ga0466722_107919 | 3300042609 | Bacteria | 31771 |
| 71 | Ga0466708_198827 | 3300042652 | Bacteria | 20273 |
| 72 | JGI24698J34947_10036300 | 3300002449 | Bacteria | 2567 |
| 73 | JGI24695J34938_10000274 | 3300002450 | Bacteria | 50501 |
| 74 | JGI24695J34938_10007357 | 3300002450 | Unclassified | 6457 |
| 75 | Ga0068305_10008967 | 3300005083 | Bacteria | 22100 |
| 76 | Ga0123357_10045724 | 3300009784 | Bacteria | 5938 |
| 77 | Ga0123353_10129165 | 3300010167 | Bacteria | 4057 |
| 78 | Ga0415639_005821 | 3300038395 | Bacteria | 15199 |
| 79 | Ga0466694_131918 | 3300042594 | Bacteria | 11046 |
| 80 | Ga0466696_023207 | 3300042596 | Bacteria | 24784 |
| 81 | Ga0466699_043250 | 3300042597 | Bacteria | 3427 |
| 82 | Ga0466712_011973 | 3300042614 | Bacteria | 32677 |
| 83 | Ga0466726_190232 | 3300042619 | Bacteria | 7380 |
| 84 | Ga0466726_200448 | 3300042619 | Bacteria | 6168 |
| 85 | Ga0466706_182139 | 3300042599 | Bacteria | 2903 |
| 86 | Ga0466709_296303 | 3300042648 | Bacteria | 26634 |
| 87 | Ga0466708_007744 | 3300042652 | Unclassified | 10088 |
| 88 | Ga0466708_275714 | 3300042652 | Bacteria | 3303 |
| 89 | Ga0072940_1038177 | 3300005200 | Bacteria | 5457 |
| 90 | Ga0123356_10001913 | 3300010049 | Bacteria | 22561 |
| 91 | Ga0123356_10002534 | 3300010049 | Bacteria | 19531 |
| 92 | Ga0222431_1006117 | 3300021190 | Bacteria | 2765 |
| 93 | Ga0466692_028541 | 3300042591 | Bacteria | 8100 |
| 94 | Ga0466694_310596 | 3300042594 | Bacteria | 2251 |
| 95 | Ga0466705_344359 | 3300042612 | Bacteria | 6746 |
| 96 | Ga0466712_220004 | 3300042614 | Unclassified | 7037 |
| 97 | Ga0466715_080210 | 3300042616 | Bacteria | 95686 |
| 98 | Ga0466715_157756 | 3300042616 | Bacteria | 4599 |
| 99 | Ga0466718_028728 | 3300042617 | Bacteria | 11087 |
| 100 | Ga0466723_314973 | 3300042618 | Bacteria | 5859 |
| 101 | Ga0466726_424060 | 3300042619 | Bacteria | 10051 |
| 102 | Ga0466719_074977 | 3300042606 | Bacteria | 14500 |
| 103 | Ga0466702_399345 | 3300042635 | Bacteria | 2904 |
| 104 | Ga0466704_129449 | 3300042643 | Bacteria | 13011 |
| 105 | Ga0466708_296978 | 3300042652 | Bacteria | 13251 |
| 106 | JGI24695J34938_10002323 | 3300002450 | Bacteria | 14643 |
| 107 | JGI24695J34938_10005175 | 3300002450 | Bacteria | 8240 |
| 108 | JGI24695J34938_10009137 | 3300002450 | Bacteria | 5543 |
| 109 | JGI24695J34938_10015971 | 3300002450 | Bacteria | 3834 |
| 110 | JGI24695J34938_10025677 | 3300002450 | Unclassified | 2812 |
| 111 | Ga0072941_1004367 | 3300005201 | Bacteria | 32939 |
| 112 | Ga0072941_1053560 | 3300005201 | Bacteria | 8156 |
| 113 | Ga0123357_10042010 | 3300009784 | Bacteria | 6219 |
| 114 | Ga0123356_10001145 | 3300010049 | Bacteria | 29294 |
| 115 | Ga0466690_426264 | 3300042590 | Bacteria | 3091 |
| 116 | Ga0466691_209197 | 3300042593 | Bacteria | 3304 |
| 117 | Ga0466694_220692 | 3300042594 | Bacteria | 5009 |
| 118 | Ga0466712_057732 | 3300042614 | Bacteria | 25744 |
| 119 | Ga0466723_056949 | 3300042618 | Bacteria | 7702 |
| 120 | Ga0466723_264949 | 3300042618 | Bacteria | 8516 |
| 121 | Ga0466704_198177 | 3300042643 | Bacteria | 51282 |
| 122 | Ga0466709_195814 | 3300042648 | Unclassified | 2973 |
| 123 | Ga0466709_205317 | 3300042648 | Bacteria | 10596 |
| 124 | Ga0123356_10000123 | 3300010049 | Bacteria | 85175 |
| 125 | Ga0123353_10002835 | 3300010167 | Bacteria | 21675 |
| 126 | Ga0123353_10010662 | 3300010167 | Bacteria | 12843 |
| 127 | Ga0123353_10066483 | 3300010167 | Bacteria | 5786 |
| 128 | Ga0123353_10116425 | 3300010167 | Bacteria | 4301 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF03176 | GO:0016020 | membrane | CC |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.