Protein Family IF00589
Metagenome
Isolate
217
Members
69
Samples
176
Scaffolds
336.34
Avg Length
Representative Sequence
- ID
- 3300002450|JGI24695J34938_10000374|JGI24695J34938_1000037420
- Length
- 333 aa
- Sequence
- MSKLIIPAGYKSVLNVYETQTAIGKIKRLFEDNLSVNLNLKRVSAPLFVDPKSGLNDDLNGVERPVEFDIKDSGMNAAIVHSLAKWKRMALHNYGFPVGEGIYTDMNAIRRDEEMDNLHSVYVDQWDWEKVIDKSSRNEDILKAVVLSIVKSICDTAVKTDPVFGSSLSRNVKFITTQQLEDLFPGSSPKERENLFVKEHKTAFIMQIGGVLKSGIKHDGRAPDYDDWTLNGDIMFWSDVLGCAIEISSMGIRVDEASLDSQLTAAGADNRRNLPFHKMLLEGKLPLTMGGGIGQSRLCMLLLQKAHIGEVQVSVWDEKTLAGCKEAGIKIL*
Sample Types
Isolate
18.9%
Metagenome
81.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
46.3%
Termitidae
34.3%
Blattidae
14.9%
Passalidae
3.0%
Kalotermitidae
1.5%
Taxonomy
Archaea
0
Bacteria
206
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 2 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 3 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 4 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 5 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 6 | 2820389254 | Unclassified Firmicutes Nc150P4bin19 | Isolate | Unclassified |
| 7 | 2820551407 | Unclassified Firmicutes Emb289P4bin38 | Isolate | Unclassified |
| 8 | 2820685979 | Unclassified Firmicutes Co191P1bin81 | Isolate | Unclassified |
| 9 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 10 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 11 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 12 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 13 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 14 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 15 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 16 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 17 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 18 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 19 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 20 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 21 | 2820673891 | Unclassified Firmicutes Co191P3bin18 | Isolate | Unclassified |
| 22 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 23 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 24 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 25 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 26 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 27 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 28 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 29 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 30 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 31 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 32 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 33 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 34 | 2940280053 | Lachnospiraceae bacterium PF1-22 | Isolate | Blattidae |
| 35 | 2944625312 | Dysgonomonas sp. PF1-3 | Isolate | Blattidae |
| 36 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 37 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 38 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 39 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 40 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 41 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 42 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 43 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 44 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 45 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 46 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 47 | 2820329821 | Unclassified Firmicutes Nt197P3bin77 | Isolate | Unclassified |
| 48 | 2820617402 | Unclassified Firmicutes Emb289P1bin131 | Isolate | Unclassified |
| 49 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 50 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 51 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 52 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 53 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 54 | 2820666966 | Unclassified Firmicutes Co191P3bin39 | Isolate | Unclassified |
| 55 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 56 | 2940286528 | Lachnospiraceae bacterium PFB1-21 | Isolate | Blattidae |
| 57 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 58 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 59 | 2820185449 | Unclassified Planctomycetes Lab288P3bin146 | Isolate | Unclassified |
| 60 | 2820644600 | Unclassified Firmicutes Cu122P5bin39 | Isolate | Unclassified |
| 61 | 8064531044 | Terrisporobacter mayombei DSM 6539 | Isolate | Unclassified |
| 62 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 63 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 64 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 65 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 66 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 67 | 2820180635 | Unclassified Planctomycetes Lab288P3bin24 | Isolate | Unclassified |
| 68 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 69 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123355_10002519 | 3300009826 | Bacteria | 25943 |
| 2 | Ga0123355_10021391 | 3300009826 | Bacteria | 10351 |
| 3 | Ga0123355_10028626 | 3300009826 | Unclassified | 9011 |
| 4 | Ga0123356_10040206 | 3300010049 | Bacteria | 4357 |
| 5 | Ga0123356_10122436 | 3300010049 | Bacteria | 2533 |
| 6 | Ga0123353_10989062 | 3300010167 | Bacteria | 1132 |
| 7 | Ga0415639_011076 | 3300038395 | Bacteria | 32364 |
| 8 | Ga0466694_052465 | 3300042594 | Bacteria | 2596 |
| 9 | Ga0466694_235857 | 3300042594 | Bacteria | 5166 |
| 10 | Ga0466702_005069 | 3300042635 | Bacteria | 1865 |
| 11 | Ga0466702_202554 | 3300042635 | Bacteria | 4076 |
| 12 | IMNBL1DRAFT_c0000961 | 3300000062 | Bacteria | 22245 |
| 13 | JGI24695J34938_10000142 | 3300002450 | Bacteria | 65463 |
| 14 | JGI24695J34938_10000258 | 3300002450 | Bacteria | 51430 |
| 15 | JGI24695J34938_10000374 | 3300002450 | Bacteria | 44420 |
| 16 | JGI24695J34938_10000772 | 3300002450 | Bacteria | 29946 |
| 17 | JGI24695J34938_10003030 | 3300002450 | Bacteria | 12060 |
| 18 | JGI24695J34938_10004729 | 3300002450 | Bacteria | 8814 |
| 19 | JGI24695J34938_10009278 | 3300002450 | Unclassified | 5484 |
| 20 | JGI24695J34938_10011219 | 3300002450 | Bacteria | 4842 |
| 21 | Ga0072941_1007836 | 3300005201 | Bacteria | 11416 |
| 22 | Ga0466712_074908 | 3300042614 | Bacteria | 23470 |
| 23 | Ga0466718_063554 | 3300042617 | Bacteria | 3105 |
| 24 | Ga0123357_10176767 | 3300009784 | Bacteria | 2507 |
| 25 | Ga0123356_10012751 | 3300010049 | Bacteria | 8140 |
| 26 | Ga0466693_360354 | 3300042592 | Bacteria | 40039 |
| 27 | Ga0466693_363515 | 3300042592 | Bacteria | 1832 |
| 28 | Ga0466694_050264 | 3300042594 | Bacteria | 4608 |
| 29 | Ga0466694_338669 | 3300042594 | Bacteria | 1223 |
| 30 | Ga0466731_129555 | 3300042622 | Bacteria | 1211 |
| 31 | Ga0466702_148387 | 3300042635 | Bacteria | 1821 |
| 32 | JGI24695J34938_10000161 | 3300002450 | Bacteria | 62308 |
| 33 | JGI24695J34938_10001590 | 3300002450 | Bacteria | 19109 |
| 34 | JGI24695J34938_10002127 | 3300002450 | Bacteria | 15466 |
| 35 | JGI24695J34938_10007867 | 3300002450 | Bacteria | 6171 |
| 36 | Ga0072941_1137224 | 3300005201 | Bacteria | 3426 |
| 37 | Ga0123357_10000146 | 3300009784 | Bacteria | 62691 |
| 38 | Ga0466712_063504 | 3300042614 | Bacteria | 1417 |
| 39 | Ga0466712_104758 | 3300042614 | Bacteria | 6780 |
| 40 | Ga0466712_150932 | 3300042614 | Bacteria | 5399 |
| 41 | Ga0466718_015159 | 3300042617 | Bacteria | 8776 |
| 42 | Ga0466720_118212 | 3300042607 | Bacteria | 10704 |
| 43 | Ga0466733_182741 | 3300042659 | Bacteria | 4727 |
| 44 | Ga0123355_10000623 | 3300009826 | Bacteria | 47876 |
| 45 | Ga0123355_10123431 | 3300009826 | Bacteria | 4011 |
| 46 | Ga0123355_10175011 | 3300009826 | Bacteria | 3198 |
| 47 | Ga0123353_10003112 | 3300010167 | Unclassified | 20814 |
| 48 | Ga0123353_10419073 | 3300010167 | Bacteria | 1985 |
| 49 | Ga0466694_167876 | 3300042594 | Unclassified | 2193 |
| 50 | IMNBL1DRAFT_c0002905 | 3300000062 | Bacteria | 11477 |
| 51 | IMNBL1DRAFT_c0013513 | 3300000062 | Bacteria | 3655 |
| 52 | JGI24698J34947_10004311 | 3300002449 | Bacteria | 7745 |
| 53 | JGI24698J34947_10014132 | 3300002449 | Bacteria | 4349 |
| 54 | JGI24698J34947_10042031 | 3300002449 | Bacteria | 2351 |
| 55 | JGI24698J34947_10044996 | 3300002449 | Bacteria | 2256 |
| 56 | JGI24698J34947_10050694 | 3300002449 | Bacteria | 2091 |
| 57 | JGI24695J34938_10006696 | 3300002450 | Bacteria | 6864 |
| 58 | JGI24695J34938_10020281 | 3300002450 | Bacteria | 3274 |
| 59 | Ga0072940_1136828 | 3300005200 | Bacteria | 5189 |
| 60 | Ga0466712_228418 | 3300042614 | Bacteria | 4154 |
| 61 | Ga0466712_301400 | 3300042614 | Bacteria | 7385 |
| 62 | Ga0466718_005511 | 3300042617 | Bacteria | 1345 |
| 63 | Ga0466718_153359 | 3300042617 | Bacteria | 3448 |
| 64 | Ga0466720_122491 | 3300042607 | Bacteria | 1578 |
| 65 | Ga0466698_086959 | 3300042610 | Bacteria | 1294 |
| 66 | Ga0466698_200117 | 3300042610 | Bacteria | 1583 |
| 67 | Ga0123355_10001344 | 3300009826 | Bacteria | 34139 |
| 68 | Ga0123355_10018862 | 3300009826 | Bacteria | 10968 |
| 69 | Ga0123355_10043642 | 3300009826 | Bacteria | 7295 |
| 70 | Ga0123355_10093687 | 3300009826 | Bacteria | 4754 |
| 71 | Ga0123355_10218113 | 3300009826 | Bacteria | 2749 |
| 72 | Ga0123356_10316494 | 3300010049 | Bacteria | 1672 |
| 73 | Ga0123353_10089607 | 3300010167 | Bacteria | 4953 |
| 74 | Ga0466699_263406 | 3300042597 | Bacteria | 2470 |
| 75 | Ga0466702_119267 | 3300042635 | Bacteria | 2444 |
| 76 | Ga0466702_359413 | 3300042635 | Bacteria | 1293 |
| 77 | IMNBL1DRAFT_c0001599 | 3300000062 | Bacteria | 16811 |
| 78 | IMNBL1DRAFT_c0009975 | 3300000062 | Bacteria | 4609 |
| 79 | AustNasuHG_c1019972 | 3300000089 | Bacteria | 2188 |
| 80 | JGI24698J34947_10004232 | 3300002449 | Unclassified | 7802 |
| 81 | JGI24698J34947_10049042 | 3300002449 | Unclassified | 2136 |
| 82 | JGI24695J34938_10000431 | 3300002450 | Bacteria | 40398 |
| 83 | JGI24695J34938_10003247 | 3300002450 | Bacteria | 11506 |
| 84 | JGI24695J34938_10004958 | 3300002450 | Bacteria | 8491 |
| 85 | JGI24695J34938_10010820 | 3300002450 | Bacteria | 4959 |
| 86 | Ga0072941_1035995 | 3300005201 | Bacteria | 1583 |
| 87 | Ga0466712_011784 | 3300042614 | Bacteria | 50228 |
| 88 | Ga0466712_114023 | 3300042614 | Bacteria | 2451 |
| 89 | Ga0466712_207429 | 3300042614 | Bacteria | 2248 |
| 90 | Ga0123357_10171519 | 3300009784 | Bacteria | 2565 |
| 91 | Ga0123357_10207529 | 3300009784 | Bacteria | 2211 |
| 92 | Ga0123357_10221343 | 3300009784 | Bacteria | 2099 |
| 93 | Ga0123355_10003557 | 3300009826 | Bacteria | 22399 |
| 94 | Ga0123355_10017880 | 3300009826 | Bacteria | 11220 |
| 95 | Ga0123356_10124057 | 3300010049 | Bacteria | 2518 |
| 96 | Ga0123356_10379071 | 3300010049 | Bacteria | 1546 |
| 97 | Ga0123353_10052415 | 3300010167 | Bacteria | 6515 |
| 98 | Ga0123353_10053109 | 3300010167 | Bacteria | 6477 |
| 99 | Ga0123353_10102510 | 3300010167 | Bacteria | 4613 |
| 100 | Ga0123353_10359391 | 3300010167 | Bacteria | 2189 |
| 101 | Ga0264413_101661 | 3300024493 | Bacteria | 35465 |
| 102 | Ga0466694_291284 | 3300042594 | Bacteria | 3767 |
| 103 | Ga0466695_115783 | 3300042595 | Bacteria | 3206 |
| 104 | 2227463520 | 2225789004 | Bacteria | 25507 |
| 105 | JGI24698J34947_10017581 | 3300002449 | Unclassified | 3874 |
| 106 | JGI24698J34947_10028651 | 3300002449 | Bacteria | 2948 |
| 107 | JGI24698J34947_10067838 | 3300002449 | Bacteria | 1728 |
| 108 | JGI24695J34938_10003541 | 3300002450 | Bacteria | 10800 |
| 109 | JGI24695J34938_10008565 | 3300002450 | Bacteria | 5817 |
| 110 | Ga0466712_002197 | 3300042614 | Bacteria | 12926 |
| 111 | Ga0466712_109095 | 3300042614 | Bacteria | 6396 |
| 112 | Ga0466712_125517 | 3300042614 | Bacteria | 6242 |
| 113 | Ga0466715_249231 | 3300042616 | Bacteria | 4645 |
| 114 | Ga0466718_002379 | 3300042617 | Bacteria | 7377 |
| 115 | Ga0466720_030065 | 3300042607 | Bacteria | 2971 |
| 116 | Ga0466698_444374 | 3300042610 | Bacteria | 1112 |
| 117 | Ga0466732_410003 | 3300042656 | Bacteria | 4316 |
| 118 | Ga0123353_10539246 | 3300010167 | Bacteria | 1687 |
| 119 | Ga0264413_107931 | 3300024493 | Bacteria | 3566 |
| 120 | Ga0415639_074838 | 3300038395 | Bacteria | 1122 |
| 121 | Ga0466693_153234 | 3300042592 | Bacteria | 5973 |
| 122 | Ga0466693_268864 | 3300042592 | Bacteria | 1861 |
| 123 | 2227141918 | 2225789004 | Bacteria | 8717 |
| 124 | AustNasuHG_c1001742 | 3300000089 | Bacteria | 7867 |
| 125 | JGI24695J34938_10001045 | 3300002450 | Bacteria | 25095 |
| 126 | JGI24695J34938_10001721 | 3300002450 | Bacteria | 18104 |
| 127 | JGI24695J34938_10002619 | 3300002450 | Bacteria | 13510 |
| 128 | JGI24695J34938_10008141 | 3300002450 | Bacteria | 6030 |
| 129 | JGI24695J34938_10011884 | 3300002450 | Bacteria | 4654 |
| 130 | JGI24695J34938_10015380 | 3300002450 | Bacteria | 3927 |
| 131 | JGI24702J35022_10088541 | 3300002462 | Bacteria | 1682 |
| 132 | JGI24703J35330_11610874 | 3300002501 | Bacteria | 1411 |
| 133 | Ga0466712_001778 | 3300042614 | Bacteria | 12454 |
| 134 | Ga0466718_041060 | 3300042617 | Bacteria | 3421 |
| 135 | Ga0466718_169346 | 3300042617 | Bacteria | 1708 |
| 136 | Ga0123355_10023768 | 3300009826 | Bacteria | 9844 |
| 137 | Ga0123355_10074868 | 3300009826 | Bacteria | 5422 |
| 138 | Ga0123355_10197552 | 3300009826 | Bacteria | 2946 |
| 139 | Ga0123355_10343828 | 3300009826 | Bacteria | 1984 |
| 140 | Ga0123356_10013661 | 3300010049 | Bacteria | 7825 |
| 141 | Ga0123353_10429395 | 3300010167 | Bacteria | 1954 |
| 142 | Ga0466694_215987 | 3300042594 | Bacteria | 19425 |
| 143 | IMNBL1DRAFT_c0005312 | 3300000062 | Bacteria | 7404 |
| 144 | JGI24698J34947_10006540 | 3300002449 | Unclassified | 6395 |
| 145 | JGI24698J34947_10033355 | 3300002449 | Bacteria | 2702 |
| 146 | JGI24698J34947_10052369 | 3300002449 | Bacteria | 2048 |
| 147 | JGI24695J34938_10002536 | 3300002450 | Bacteria | 13813 |
| 148 | Ga0466712_104262 | 3300042614 | Bacteria | 4286 |
| 149 | Ga0466712_140545 | 3300042614 | Bacteria | 3719 |
| 150 | Ga0466712_210346 | 3300042614 | Bacteria | 17066 |
| 151 | Ga0466718_069173 | 3300042617 | Bacteria | 3131 |
| 152 | Ga0466732_022399 | 3300042656 | Unclassified | 2374 |
| 153 | Ga0123357_10043421 | 3300009784 | Bacteria | 6110 |
| 154 | Ga0123355_10000291 | 3300009826 | Bacteria | 64274 |
| 155 | Ga0123355_10003808 | 3300009826 | Bacteria | 21812 |
| 156 | Ga0123355_10213022 | 3300009826 | Bacteria | 2795 |
| 157 | Ga0123356_10012810 | 3300010049 | Bacteria | 8118 |
| 158 | Ga0123353_10001160 | 3300010167 | Bacteria | 32155 |
| 159 | Ga0264413_122023 | 3300024493 | Bacteria | 3649 |
| 160 | Ga0466693_199471 | 3300042592 | Bacteria | 54862 |
| 161 | Ga0466694_233120 | 3300042594 | Bacteria | 7754 |
| 162 | Ga0466694_276745 | 3300042594 | Bacteria | 1184 |
| 163 | Ga0466694_355808 | 3300042594 | Bacteria | 2392 |
| 164 | IMNBL1DRAFT_c0001075 | 3300000062 | Bacteria | 21014 |
| 165 | JGI24698J34947_10018143 | 3300002449 | Bacteria | 3807 |
| 166 | JGI24698J34947_10045002 | 3300002449 | Unclassified | 2255 |
| 167 | JGI24695J34938_10000003 | 3300002450 | Bacteria | 167365 |
| 168 | JGI24695J34938_10001175 | 3300002450 | Bacteria | 23277 |
| 169 | JGI24695J34938_10001717 | 3300002450 | Bacteria | 18123 |
| 170 | JGI24695J34938_10064774 | 3300002450 | Bacteria | 1545 |
| 171 | JGI24695J34938_10076542 | 3300002450 | Bacteria | 1389 |
| 172 | JGI24702J35022_10016274 | 3300002462 | Bacteria | 4078 |
| 173 | Ga0072941_1101864 | 3300005201 | Bacteria | 1330 |
| 174 | Ga0466712_267322 | 3300042614 | Unclassified | 2202 |
| 175 | Ga0466718_030520 | 3300042617 | Bacteria | 4568 |
| 176 | Ga0466718_060935 | 3300042617 | Bacteria | 23103 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03590 | AsnA | Aspartate-ammonia ligase | 20 | 241 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.