Protein Family IF00574
Metagenome
Isolate
154
Members
47
Samples
150
Scaffolds
108.39
Avg Length
Representative Sequence
- ID
- 3300002449|JGI24698J34947_10310011|JGI24698J34947_103100111
- Length
- 127 aa
- Sequence
- LINGQELRSILGKGIRFYRQQRKLSQADLAEKANISITFLSNIERGIKYPTSDTLSSIANGLDIEVYELFRHDHSPVEHRMLFERFKTDISKNVIEALEAVYKLYDELPSSEITDKELDDGLDKGR*
Sample Types
Isolate
2.6%
Metagenome
97.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
68.9%
Kalotermitidae
13.3%
Unclassified
11.1%
Rhinotermitidae
4.4%
Termopsidae
2.2%
Taxonomy
Archaea
0
Bacteria
129
Eukaryota
0
Viruses
1
Unclassified
24
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 2 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 3 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 4 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 5 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 6 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 7 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 8 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 9 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 10 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 11 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 12 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 13 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 14 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 15 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 16 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 17 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 18 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 19 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 20 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 21 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 22 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 23 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 24 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 25 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 26 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 27 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 28 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 29 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 30 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 31 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 32 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 33 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 34 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 35 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 36 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 37 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 38 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 39 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 40 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 41 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 42 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 43 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 44 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 45 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 46 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 47 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_042581 | 3300042656 | Bacteria | 8025 |
| 2 | Ga0466731_037474 | 3300042622 | Bacteria | 1429 |
| 3 | Ga0466731_407247 | 3300042622 | Bacteria | 1271 |
| 4 | Ga0466708_244131 | 3300042652 | Bacteria | 3173 |
| 5 | Ga0466720_091896 | 3300042607 | Bacteria | 5820 |
| 6 | Ga0466722_065482 | 3300042609 | Unclassified | 2558 |
| 7 | Ga0264413_110401 | 3300024493 | Viruses | 1587 |
| 8 | Ga0466699_374441 | 3300042597 | Bacteria | 1211 |
| 9 | Ga0123357_10080841 | 3300009784 | Bacteria | 4273 |
| 10 | Ga0123356_10310120 | 3300010049 | Bacteria | 1687 |
| 11 | Ga0123356_11685301 | 3300010049 | Bacteria | 786 |
| 12 | Ga0123356_12106918 | 3300010049 | Bacteria | 704 |
| 13 | JGI24698J34947_10317051 | 3300002449 | Unclassified | 556 |
| 14 | JGI24695J34938_10005520 | 3300002450 | Bacteria | 7858 |
| 15 | JGI24695J34938_10038700 | 3300002450 | Bacteria | 2159 |
| 16 | Ga0072941_1054688 | 3300005201 | Bacteria | 1723 |
| 17 | Ga0072941_1085427 | 3300005201 | Bacteria | 1494 |
| 18 | Ga0466712_126412 | 3300042614 | Bacteria | 1687 |
| 19 | Ga0466712_171698 | 3300042614 | Unclassified | 1355 |
| 20 | Ga0466718_091130 | 3300042617 | Unclassified | 1179 |
| 21 | Ga0466718_101041 | 3300042617 | Bacteria | 1482 |
| 22 | Ga0466705_219732 | 3300042612 | Bacteria | 4727 |
| 23 | Ga0466732_151224 | 3300042656 | Bacteria | 10074 |
| 24 | Ga0466735_032875 | 3300042624 | Bacteria | 6023 |
| 25 | Ga0466702_302984 | 3300042635 | Bacteria | 1100 |
| 26 | Ga0264413_127354 | 3300024493 | Bacteria | 3200 |
| 27 | Ga0415639_022876 | 3300038395 | Bacteria | 2385 |
| 28 | Ga0466656_003812 | 3300042550 | Bacteria | 1064 |
| 29 | Ga0123356_11173634 | 3300010049 | Bacteria | 934 |
| 30 | Ga0123356_11313998 | 3300010049 | Bacteria | 886 |
| 31 | Ga0123353_11049884 | 3300010167 | Bacteria | 1088 |
| 32 | AustNasuHG_c1002478 | 3300000089 | Bacteria | 6682 |
| 33 | JGI24698J34947_10003688 | 3300002449 | Bacteria | 8328 |
| 34 | JGI24698J34947_10090661 | 3300002449 | Bacteria | 1404 |
| 35 | JGI24698J34947_10151261 | 3300002449 | Bacteria | 963 |
| 36 | JGI24695J34938_10000085 | 3300002450 | Bacteria | 80617 |
| 37 | JGI24695J34938_10023146 | 3300002450 | Bacteria | 3000 |
| 38 | JGI24695J34938_10099701 | 3300002450 | Bacteria | 1187 |
| 39 | Ga0072940_1052933 | 3300005200 | Bacteria | 3048 |
| 40 | Ga0466735_205074 | 3300042624 | Bacteria | 1311 |
| 41 | Ga0466700_404043 | 3300042600 | Bacteria | 1021 |
| 42 | Ga0264413_127130 | 3300024493 | Bacteria | 1299 |
| 43 | Ga0466656_243542 | 3300042550 | Bacteria | 1075 |
| 44 | Ga0466692_171106 | 3300042591 | Bacteria | 26578 |
| 45 | Ga0466694_102421 | 3300042594 | Bacteria | 6214 |
| 46 | Ga0466694_263130 | 3300042594 | Unclassified | 8562 |
| 47 | Ga0466699_079846 | 3300042597 | Unclassified | 4277 |
| 48 | Ga0123356_10242685 | 3300010049 | Bacteria | 1874 |
| 49 | JGI24698J34947_10042737 | 3300002449 | Unclassified | 2327 |
| 50 | JGI24695J34938_10014572 | 3300002450 | Bacteria | 4070 |
| 51 | JGI24695J34938_10021043 | 3300002450 | Bacteria | 3199 |
| 52 | JGI24695J34938_10144411 | 3300002450 | Bacteria | 973 |
| 53 | JGI24702J35022_10023113 | 3300002462 | Bacteria | 3362 |
| 54 | Ga0466733_195308 | 3300042659 | Bacteria | 1333 |
| 55 | Ga0466731_183149 | 3300042622 | Bacteria | 2559 |
| 56 | Ga0466704_159139 | 3300042643 | Bacteria | 5191 |
| 57 | Ga0466707_121728 | 3300042601 | Unclassified | 1303 |
| 58 | Ga0466717_263657 | 3300042604 | Bacteria | 1427 |
| 59 | Ga0466721_007525 | 3300042608 | Bacteria | 1083 |
| 60 | Ga0466722_035727 | 3300042609 | Bacteria | 4013 |
| 61 | Ga0466722_217363 | 3300042609 | Bacteria | 5217 |
| 62 | Ga0466656_016886 | 3300042550 | Bacteria | 1721 |
| 63 | Ga0466694_344019 | 3300042594 | Unclassified | 3456 |
| 64 | Ga0123356_10252010 | 3300010049 | Bacteria | 1844 |
| 65 | JGI24698J34947_10022094 | 3300002449 | Bacteria | 3414 |
| 66 | JGI24698J34947_10088050 | 3300002449 | Bacteria | 1434 |
| 67 | JGI24698J34947_10174666 | 3300002449 | Bacteria | 865 |
| 68 | JGI24698J34947_10310011 | 3300002449 | Bacteria | 566 |
| 69 | JGI24695J34938_10000690 | 3300002450 | Bacteria | 31868 |
| 70 | JGI24695J34938_10107938 | 3300002450 | Unclassified | 1135 |
| 71 | JGI24695J34938_10125686 | 3300002450 | Bacteria | 1045 |
| 72 | Ga0072940_1001139 | 3300005200 | Unclassified | 5848 |
| 73 | Ga0072941_1085428 | 3300005201 | Bacteria | 1187 |
| 74 | Ga0466718_001804 | 3300042617 | Bacteria | 57227 |
| 75 | Ga0466718_003040 | 3300042617 | Bacteria | 1547 |
| 76 | Ga0466732_018977 | 3300042656 | Bacteria | 1101 |
| 77 | Ga0466720_122537 | 3300042607 | Bacteria | 27632 |
| 78 | Ga0466720_191513 | 3300042607 | Bacteria | 1334 |
| 79 | Ga0466699_376953 | 3300042597 | Unclassified | 1704 |
| 80 | Ga0123355_10869629 | 3300009826 | Bacteria | 987 |
| 81 | Ga0123356_10701062 | 3300010049 | Bacteria | 1181 |
| 82 | Ga0123353_10624476 | 3300010167 | Bacteria | 1533 |
| 83 | Ga0123353_10926358 | 3300010167 | Bacteria | 1182 |
| 84 | JGI24695J34938_10054178 | 3300002450 | Bacteria | 1740 |
| 85 | Ga0072941_1000226 | 3300005201 | Bacteria | 13991 |
| 86 | Ga0072941_1000593 | 3300005201 | Bacteria | 20958 |
| 87 | Ga0466712_068557 | 3300042614 | Unclassified | 2222 |
| 88 | Ga0466712_268372 | 3300042614 | Unclassified | 2242 |
| 89 | Ga0466718_080039 | 3300042617 | Unclassified | 1082 |
| 90 | Ga0466732_223436 | 3300042656 | Unclassified | 1929 |
| 91 | Ga0466704_188505 | 3300042643 | Unclassified | 3695 |
| 92 | Ga0466720_117905 | 3300042607 | Bacteria | 1621 |
| 93 | Ga0466722_000894 | 3300042609 | Bacteria | 4851 |
| 94 | Ga0466656_324465 | 3300042550 | Bacteria | 1363 |
| 95 | Ga0466692_015258 | 3300042591 | Unclassified | 1625 |
| 96 | Ga0123355_10001523 | 3300009826 | Bacteria | 32337 |
| 97 | Ga0123356_12776873 | 3300010049 | Bacteria | 613 |
| 98 | JGI24698J34947_10144743 | 3300002449 | Bacteria | 996 |
| 99 | JGI24698J34947_10304151 | 3300002449 | Bacteria | 573 |
| 100 | JGI24695J34938_10001838 | 3300002450 | Bacteria | 17281 |
| 101 | JGI24695J34938_10041432 | 3300002450 | Bacteria | 2068 |
| 102 | JGI24695J34938_10076370 | 3300002450 | Bacteria | 1391 |
| 103 | JGI24695J34938_10182113 | 3300002450 | Bacteria | 870 |
| 104 | JGI24695J34938_10240229 | 3300002450 | Bacteria | 766 |
| 105 | JGI24705J35276_11543268 | 3300002504 | Bacteria | 571 |
| 106 | Ga0466718_101931 | 3300042617 | Bacteria | 1009 |
| 107 | Ga0466718_111740 | 3300042617 | Unclassified | 7636 |
| 108 | Ga0466731_158443 | 3300042622 | Bacteria | 2368 |
| 109 | Ga0466702_323727 | 3300042635 | Bacteria | 1855 |
| 110 | Ga0466703_226099 | 3300042636 | Bacteria | 3115 |
| 111 | Ga0466699_192834 | 3300042597 | Unclassified | 1727 |
| 112 | Ga0466699_261883 | 3300042597 | Unclassified | 1270 |
| 113 | Ga0466699_387829 | 3300042597 | Bacteria | 10185 |
| 114 | Ga0123357_10276175 | 3300009784 | Bacteria | 1745 |
| 115 | Ga0123353_10921994 | 3300010167 | Bacteria | 1186 |
| 116 | Ga0123354_10641170 | 3300010882 | Bacteria | 762 |
| 117 | Nasutiter_Contig21661 | 2030936001 | Bacteria | 582 |
| 118 | Ga0072940_1005472 | 3300005200 | Unclassified | 3802 |
| 119 | Ga0072941_1044371 | 3300005201 | Bacteria | 4071 |
| 120 | Ga0072941_1341269 | 3300005201 | Bacteria | 1336 |
| 121 | Ga0466711_091292 | 3300042615 | Bacteria | 9544 |
| 122 | Ga0466711_444737 | 3300042615 | Bacteria | 1372 |
| 123 | Ga0466715_195905 | 3300042616 | Bacteria | 1700 |
| 124 | Ga0466718_123458 | 3300042617 | Bacteria | 1245 |
| 125 | Ga0466732_437638 | 3300042656 | Bacteria | 15055 |
| 126 | Ga0466731_255040 | 3300042622 | Bacteria | 1764 |
| 127 | Ga0466734_171094 | 3300042623 | Bacteria | 2446 |
| 128 | Ga0466702_449153 | 3300042635 | Bacteria | 1469 |
| 129 | Ga0466700_170481 | 3300042600 | Bacteria | 1155 |
| 130 | Ga0466720_231164 | 3300042607 | Unclassified | 6046 |
| 131 | Ga0466722_010375 | 3300042609 | Bacteria | 2089 |
| 132 | Ga0466698_121109 | 3300042610 | Bacteria | 4082 |
| 133 | Ga0466657_148574 | 3300042582 | Unclassified | 1605 |
| 134 | Ga0466694_173719 | 3300042594 | Bacteria | 2895 |
| 135 | Ga0466695_183519 | 3300042595 | Bacteria | 10066 |
| 136 | Ga0123356_12024953 | 3300010049 | Bacteria | 718 |
| 137 | Ga0123353_10400608 | 3300010167 | Bacteria | 2043 |
| 138 | Ga0123353_10949944 | 3300010167 | Bacteria | 1163 |
| 139 | AustNasuHG_c1029126 | 3300000089 | Bacteria | 1627 |
| 140 | JGI24695J34938_10002146 | 3300002450 | Bacteria | 15411 |
| 141 | JGI24702J35022_10020375 | 3300002462 | Bacteria | 3601 |
| 142 | JGI24699J35502_10322623 | 3300002509 | Bacteria | 528 |
| 143 | JGI24699J35502_10850839 | 3300002509 | Bacteria | 955 |
| 144 | Ga0072940_1069864 | 3300005200 | Bacteria | 710 |
| 145 | Ga0072940_1282407 | 3300005200 | Bacteria | 757 |
| 146 | Ga0466705_415569 | 3300042612 | Bacteria | 2187 |
| 147 | Ga0466712_004889 | 3300042614 | Bacteria | 4183 |
| 148 | Ga0466712_113961 | 3300042614 | Bacteria | 2816 |
| 149 | Ga0466718_007102 | 3300042617 | Bacteria | 3267 |
| 150 | Ga0466718_170700 | 3300042617 | Bacteria | 5932 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.