Protein Family IF00561
Metagenome
Isolate
275
Members
58
Samples
267
Scaffolds
151.32
Avg Length
Representative Sequence
- ID
- 3300002449|JGI24698J34947_10115867|JGI24698J34947_101158671
- Length
- 171 aa
- Sequence
- LLALRVFQAGDSRQGTAVSEGVKVIAVNRKARHDYTIDDSYECGIELLGTEVKSFRDGKISFPDAWAEVAGKEVWLRSLRIAENPFSSVFNHDPDRKKKLLLHRDEIKRITRKTEEKGYTLIPLSFYFKRGRVKVELGLCKGKKQYDKRADIRERDIKRDVAREFRKGLQ*
Sample Types
Isolate
2.9%
Metagenome
97.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
43.6%
Kalotermitidae
25.5%
Unclassified
16.4%
Rhinotermitidae
7.3%
Termopsidae
5.5%
Blaberidae
1.8%
Taxonomy
Archaea
0
Bacteria
236
Eukaryota
0
Viruses
1
Unclassified
38
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 2 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 3 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 4 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 5 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 6 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 7 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 8 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 9 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 10 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 11 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 12 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 13 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 14 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 15 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 16 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 17 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 18 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 19 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 20 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 21 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 22 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 23 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 24 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 25 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 26 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 27 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 28 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 29 | 2781125653 | Treponema sp. Emb289P1bin107 | Isolate | Unclassified |
| 30 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 31 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 32 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 33 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 34 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 35 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 36 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 37 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 38 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 39 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 40 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 41 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 42 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 43 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 44 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 45 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 46 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 47 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 48 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 49 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 50 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 51 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 52 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 53 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 54 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 55 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 56 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 57 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 58 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_206748 | 3300042656 | Bacteria | 33874 |
| 2 | Ga0466733_205085 | 3300042659 | Bacteria | 1031 |
| 3 | Ga0466712_118553 | 3300042614 | Bacteria | 7916 |
| 4 | Ga0466715_043987 | 3300042616 | Bacteria | 9658 |
| 5 | Ga0466715_124367 | 3300042616 | Bacteria | 1902 |
| 6 | Ga0466715_399395 | 3300042616 | Viruses | 2116 |
| 7 | Ga0466718_011959 | 3300042617 | Bacteria | 2926 |
| 8 | Ga0466723_079211 | 3300042618 | Bacteria | 4937 |
| 9 | Ga0466726_016209 | 3300042619 | Bacteria | 9445 |
| 10 | Ga0466726_142733 | 3300042619 | Bacteria | 1993 |
| 11 | Ga0466728_217427 | 3300042620 | Bacteria | 15359 |
| 12 | Ga0466728_273786 | 3300042620 | Unclassified | 4282 |
| 13 | Ga0466728_275030 | 3300042620 | Bacteria | 1769 |
| 14 | Ga0466728_373137 | 3300042620 | Bacteria | 5670 |
| 15 | Ga0123355_10561289 | 3300009826 | Bacteria | 1375 |
| 16 | Ga0466691_091314 | 3300042593 | Bacteria | 7514 |
| 17 | Ga0466694_275037 | 3300042594 | Bacteria | 5866 |
| 18 | Ga0466696_170806 | 3300042596 | Bacteria | 4496 |
| 19 | Ga0466699_070464 | 3300042597 | Bacteria | 15230 |
| 20 | Ga0466699_169977 | 3300042597 | Bacteria | 8838 |
| 21 | Ga0466699_287637 | 3300042597 | Bacteria | 9919 |
| 22 | Ga0466707_334867 | 3300042601 | Bacteria | 1332 |
| 23 | Ga0466720_174076 | 3300042607 | Unclassified | 1363 |
| 24 | Ga0466720_192205 | 3300042607 | Bacteria | 27673 |
| 25 | Ga0466735_030238 | 3300042624 | Bacteria | 1138 |
| 26 | Ga0466703_133572 | 3300042636 | Bacteria | 9163 |
| 27 | Ga0466703_330768 | 3300042636 | Bacteria | 4830 |
| 28 | Ga0466704_313628 | 3300042643 | Bacteria | 2767 |
| 29 | Ga0466704_372016 | 3300042643 | Bacteria | 2965 |
| 30 | Ga0466709_255792 | 3300042648 | Bacteria | 2541 |
| 31 | Ga0466709_256626 | 3300042648 | Bacteria | 4196 |
| 32 | Ga0466708_212248 | 3300042652 | Bacteria | 23369 |
| 33 | FAAS_10443529 | 3300001880 | Bacteria | 566 |
| 34 | JGI24698J34947_10006794 | 3300002449 | Bacteria | 6287 |
| 35 | JGI24695J34938_10004654 | 3300002450 | Unclassified | 8912 |
| 36 | Ga0072941_1012034 | 3300005201 | Bacteria | 9815 |
| 37 | Ga0466732_030737 | 3300042656 | Unclassified | 4055 |
| 38 | Ga0466732_435657 | 3300042656 | Bacteria | 1294 |
| 39 | Ga0466733_159805 | 3300042659 | Bacteria | 1293 |
| 40 | Ga0466712_162961 | 3300042614 | Bacteria | 6924 |
| 41 | Ga0466715_053951 | 3300042616 | Bacteria | 20752 |
| 42 | Ga0466715_111754 | 3300042616 | Bacteria | 6639 |
| 43 | Ga0466718_006304 | 3300042617 | Bacteria | 1074 |
| 44 | Ga0466723_224100 | 3300042618 | Unclassified | 2294 |
| 45 | Ga0466726_011660 | 3300042619 | Bacteria | 5815 |
| 46 | Ga0466728_123580 | 3300042620 | Bacteria | 20023 |
| 47 | Ga0466729_074172 | 3300042621 | Bacteria | 1266 |
| 48 | Ga0123355_10056743 | 3300009826 | Bacteria | 6338 |
| 49 | Ga0123353_10263184 | 3300010167 | Bacteria | 2662 |
| 50 | Ga0123354_10380697 | 3300010882 | Bacteria | 1219 |
| 51 | Ga0264413_103206 | 3300024493 | Bacteria | 11372 |
| 52 | Ga0264413_111292 | 3300024493 | Unclassified | 7452 |
| 53 | Ga0415639_046491 | 3300038395 | Bacteria | 5290 |
| 54 | Ga0466690_001409 | 3300042590 | Unclassified | 1127 |
| 55 | Ga0466692_103240 | 3300042591 | Bacteria | 34606 |
| 56 | Ga0466694_188429 | 3300042594 | Bacteria | 57168 |
| 57 | Ga0466694_252400 | 3300042594 | Bacteria | 3197 |
| 58 | Ga0466694_326263 | 3300042594 | Unclassified | 2628 |
| 59 | Ga0466699_102584 | 3300042597 | Bacteria | 1621 |
| 60 | Ga0466707_098700 | 3300042601 | Unclassified | 1050 |
| 61 | Ga0466719_040774 | 3300042606 | Bacteria | 13696 |
| 62 | Ga0466719_110783 | 3300042606 | Bacteria | 4061 |
| 63 | Ga0466722_025146 | 3300042609 | Bacteria | 6377 |
| 64 | Ga0466722_157319 | 3300042609 | Bacteria | 1486 |
| 65 | Ga0466722_210558 | 3300042609 | Bacteria | 2456 |
| 66 | Ga0466704_381443 | 3300042643 | Bacteria | 9348 |
| 67 | Ga0466704_435587 | 3300042643 | Bacteria | 22519 |
| 68 | Ga0466709_314912 | 3300042648 | Bacteria | 4792 |
| 69 | Ga0466708_307405 | 3300042652 | Bacteria | 3590 |
| 70 | JGI24698J34947_10000047 | 3300002449 | Bacteria | 35439 |
| 71 | JGI24698J34947_10184143 | 3300002449 | Bacteria | 832 |
| 72 | JGI24695J34938_10006801 | 3300002450 | Bacteria | 6788 |
| 73 | JGI24695J34938_10015696 | 3300002450 | Bacteria | 3877 |
| 74 | Ga0072941_1001322 | 3300005201 | Bacteria | 25096 |
| 75 | Ga0466733_009678 | 3300042659 | Bacteria | 13023 |
| 76 | Ga0466712_167902 | 3300042614 | Bacteria | 4156 |
| 77 | Ga0466715_153436 | 3300042616 | Bacteria | 20541 |
| 78 | Ga0466715_207896 | 3300042616 | Bacteria | 3134 |
| 79 | Ga0466715_289333 | 3300042616 | Bacteria | 11333 |
| 80 | Ga0466715_506064 | 3300042616 | Bacteria | 5262 |
| 81 | Ga0466718_085182 | 3300042617 | Bacteria | 3968 |
| 82 | Ga0466718_153168 | 3300042617 | Bacteria | 1200 |
| 83 | Ga0466723_121853 | 3300042618 | Unclassified | 3076 |
| 84 | Ga0466723_293752 | 3300042618 | Bacteria | 3464 |
| 85 | Ga0466726_356528 | 3300042619 | Bacteria | 3983 |
| 86 | Ga0466728_106494 | 3300042620 | Bacteria | 8084 |
| 87 | Ga0466728_384769 | 3300042620 | Bacteria | 1989 |
| 88 | Ga0466690_130954 | 3300042590 | Bacteria | 6460 |
| 89 | Ga0466691_107007 | 3300042593 | Bacteria | 3186 |
| 90 | Ga0466696_288483 | 3300042596 | Bacteria | 26421 |
| 91 | Ga0466707_044304 | 3300042601 | Bacteria | 1080 |
| 92 | Ga0466707_126084 | 3300042601 | Bacteria | 2254 |
| 93 | Ga0466719_492054 | 3300042606 | Bacteria | 2035 |
| 94 | Ga0466720_073219 | 3300042607 | Bacteria | 29974 |
| 95 | Ga0466698_433752 | 3300042610 | Bacteria | 1497 |
| 96 | Ga0466704_024511 | 3300042643 | Bacteria | 22738 |
| 97 | Ga0466704_368440 | 3300042643 | Bacteria | 28623 |
| 98 | Ga0466704_535105 | 3300042643 | Bacteria | 5159 |
| 99 | Ga0466727_076492 | 3300042655 | Bacteria | 3117 |
| 100 | Ga0466727_123207 | 3300042655 | Bacteria | 1902 |
| 101 | JGI24698J34947_10002098 | 3300002449 | Bacteria | 10661 |
| 102 | JGI24698J34947_10029931 | 3300002449 | Bacteria | 2874 |
| 103 | JGI24698J34947_10036936 | 3300002449 | Bacteria | 2541 |
| 104 | JGI24698J34947_10041599 | 3300002449 | Bacteria | 2366 |
| 105 | JGI24695J34938_10064011 | 3300002450 | Bacteria | 1557 |
| 106 | JGI24705J35276_11772540 | 3300002504 | Bacteria | 668 |
| 107 | Ga0466705_360288 | 3300042612 | Bacteria | 5069 |
| 108 | Ga0466732_083039 | 3300042656 | Bacteria | 3743 |
| 109 | Ga0466732_428231 | 3300042656 | Unclassified | 1838 |
| 110 | Ga0466705_404111 | 3300042612 | Bacteria | 13809 |
| 111 | Ga0466705_458132 | 3300042612 | Bacteria | 4007 |
| 112 | Ga0466712_003390 | 3300042614 | Unclassified | 7030 |
| 113 | Ga0466712_045524 | 3300042614 | Bacteria | 5301 |
| 114 | Ga0466712_180410 | 3300042614 | Unclassified | 7115 |
| 115 | Ga0466715_555135 | 3300042616 | Unclassified | 10556 |
| 116 | Ga0466718_016271 | 3300042617 | Bacteria | 23380 |
| 117 | Ga0466723_136601 | 3300042618 | Bacteria | 6126 |
| 118 | Ga0466726_013545 | 3300042619 | Bacteria | 1276 |
| 119 | Ga0466726_159351 | 3300042619 | Bacteria | 2255 |
| 120 | Ga0123356_12043890 | 3300010049 | Bacteria | 715 |
| 121 | Ga0466690_092360 | 3300042590 | Bacteria | 12914 |
| 122 | Ga0466690_417799 | 3300042590 | Bacteria | 4231 |
| 123 | Ga0466694_323269 | 3300042594 | Bacteria | 2141 |
| 124 | Ga0466695_162681 | 3300042595 | Bacteria | 8790 |
| 125 | Ga0466696_134684 | 3300042596 | Bacteria | 1429 |
| 126 | Ga0466699_148306 | 3300042597 | Bacteria | 3203 |
| 127 | Ga0466720_013764 | 3300042607 | Bacteria | 5471 |
| 128 | Ga0466720_053216 | 3300042607 | Bacteria | 30257 |
| 129 | Ga0466720_055303 | 3300042607 | Unclassified | 4370 |
| 130 | Ga0466722_166822 | 3300042609 | Bacteria | 35787 |
| 131 | Ga0466703_052771 | 3300042636 | Bacteria | 22250 |
| 132 | Ga0466703_066767 | 3300042636 | Bacteria | 8797 |
| 133 | Ga0466703_292012 | 3300042636 | Bacteria | 42783 |
| 134 | Ga0466704_322932 | 3300042643 | Bacteria | 9266 |
| 135 | Ga0466704_470295 | 3300042643 | Bacteria | 34987 |
| 136 | Ga0466704_514518 | 3300042643 | Bacteria | 6381 |
| 137 | Ga0466709_194846 | 3300042648 | Bacteria | 7188 |
| 138 | Ga0466708_061532 | 3300042652 | Bacteria | 43570 |
| 139 | Ga0466708_403390 | 3300042652 | Bacteria | 13339 |
| 140 | Ga0466708_417541 | 3300042652 | Bacteria | 43144 |
| 141 | Ga0466727_284125 | 3300042655 | Bacteria | 5762 |
| 142 | JGI24698J34947_10115867 | 3300002449 | Bacteria | 1173 |
| 143 | Ga0466711_023968 | 3300042615 | Unclassified | 4019 |
| 144 | Ga0466711_277456 | 3300042615 | Bacteria | 7621 |
| 145 | Ga0466711_516912 | 3300042615 | Bacteria | 2291 |
| 146 | Ga0466715_125869 | 3300042616 | Bacteria | 2468 |
| 147 | Ga0466715_129271 | 3300042616 | Unclassified | 6775 |
| 148 | Ga0466715_205836 | 3300042616 | Bacteria | 7039 |
| 149 | Ga0466715_316211 | 3300042616 | Bacteria | 16355 |
| 150 | Ga0466715_571275 | 3300042616 | Bacteria | 11392 |
| 151 | Ga0466723_031805 | 3300042618 | Bacteria | 21552 |
| 152 | Ga0466723_149026 | 3300042618 | Bacteria | 4967 |
| 153 | Ga0466726_227872 | 3300042619 | Bacteria | 1134 |
| 154 | Ga0466728_026152 | 3300042620 | Unclassified | 4249 |
| 155 | Ga0466728_160193 | 3300042620 | Bacteria | 15278 |
| 156 | Ga0466729_091852 | 3300042621 | Bacteria | 2275 |
| 157 | Ga0123353_10037416 | 3300010167 | Bacteria | 7613 |
| 158 | Ga0123353_11957150 | 3300010167 | Bacteria | 720 |
| 159 | Ga0123354_10193857 | 3300010882 | Bacteria | 2263 |
| 160 | Ga0466693_112108 | 3300042592 | Bacteria | 1854 |
| 161 | Ga0466691_146792 | 3300042593 | Bacteria | 3650 |
| 162 | Ga0466699_040675 | 3300042597 | Bacteria | 30805 |
| 163 | Ga0466719_022408 | 3300042606 | Bacteria | 4717 |
| 164 | Ga0466722_104195 | 3300042609 | Bacteria | 4356 |
| 165 | Ga0466722_217396 | 3300042609 | Bacteria | 2694 |
| 166 | Ga0466708_094848 | 3300042652 | Bacteria | 1692 |
| 167 | Ga0466708_173332 | 3300042652 | Bacteria | 1948 |
| 168 | Ga0466727_166109 | 3300042655 | Bacteria | 1542 |
| 169 | Nasutiter_Contig44233 | 2030936001 | Unclassified | 623 |
| 170 | AustNasuHG_c1027343 | 3300000089 | Bacteria | 1745 |
| 171 | JGI24695J34938_10084983 | 3300002450 | Bacteria | 1304 |
| 172 | JGI24695J34938_10125619 | 3300002450 | Bacteria | 1045 |
| 173 | Ga0466705_220766 | 3300042612 | Bacteria | 8458 |
| 174 | Ga0466732_153465 | 3300042656 | Bacteria | 2074 |
| 175 | Ga0466705_455298 | 3300042612 | Unclassified | 3178 |
| 176 | Ga0466712_054625 | 3300042614 | Unclassified | 3070 |
| 177 | Ga0466711_224746 | 3300042615 | Bacteria | 2538 |
| 178 | Ga0466726_488067 | 3300042619 | Bacteria | 1016 |
| 179 | Ga0123357_10192972 | 3300009784 | Bacteria | 2341 |
| 180 | Ga0456237_0014123 | 3300041968 | Bacteria | 1139 |
| 181 | Ga0466690_277688 | 3300042590 | Bacteria | 5190 |
| 182 | Ga0466692_188173 | 3300042591 | Bacteria | 1601 |
| 183 | Ga0466691_130702 | 3300042593 | Bacteria | 35179 |
| 184 | Ga0466691_146851 | 3300042593 | Bacteria | 11970 |
| 185 | Ga0466696_350113 | 3300042596 | Bacteria | 3883 |
| 186 | Ga0466699_213466 | 3300042597 | Bacteria | 3170 |
| 187 | Ga0466699_387582 | 3300042597 | Bacteria | 7075 |
| 188 | Ga0466713_058421 | 3300042602 | Bacteria | 3777 |
| 189 | Ga0466716_345681 | 3300042605 | Bacteria | 6599 |
| 190 | Ga0466716_377362 | 3300042605 | Unclassified | 3629 |
| 191 | Ga0466719_046756 | 3300042606 | Bacteria | 2760 |
| 192 | Ga0466719_304898 | 3300042606 | Unclassified | 1791 |
| 193 | Ga0466722_035222 | 3300042609 | Bacteria | 6924 |
| 194 | Ga0466722_036797 | 3300042609 | Bacteria | 1743 |
| 195 | Ga0466722_252203 | 3300042609 | Bacteria | 4966 |
| 196 | Ga0466722_263012 | 3300042609 | Bacteria | 1174 |
| 197 | Ga0466729_308273 | 3300042621 | Bacteria | 1173 |
| 198 | Ga0466703_018934 | 3300042636 | Bacteria | 6493 |
| 199 | Ga0466703_364328 | 3300042636 | Bacteria | 4874 |
| 200 | Ga0466704_105528 | 3300042643 | Bacteria | 3024 |
| 201 | Ga0466709_356593 | 3300042648 | Bacteria | 6710 |
| 202 | Ga0466727_235316 | 3300042655 | Bacteria | 6867 |
| 203 | AustNasuHG_c1003449 | 3300000089 | Bacteria | 5707 |
| 204 | JGI24698J34947_10093335 | 3300002449 | Unclassified | 1374 |
| 205 | JGI24698J34947_10184743 | 3300002449 | Bacteria | 830 |
| 206 | JGI24702J35022_10060449 | 3300002462 | Bacteria | 2026 |
| 207 | Ga0466732_141448 | 3300042656 | Bacteria | 11316 |
| 208 | Ga0466733_008378 | 3300042659 | Bacteria | 1200 |
| 209 | Ga0466712_040592 | 3300042614 | Bacteria | 2109 |
| 210 | Ga0466715_037735 | 3300042616 | Bacteria | 10941 |
| 211 | Ga0466723_267244 | 3300042618 | Bacteria | 2037 |
| 212 | Ga0466728_120129 | 3300042620 | Bacteria | 2862 |
| 213 | Ga0123357_10305717 | 3300009784 | Unclassified | 1597 |
| 214 | Ga0123356_10001011 | 3300010049 | Bacteria | 31243 |
| 215 | Ga0264413_105433 | 3300024493 | Bacteria | 15894 |
| 216 | Ga0466690_053887 | 3300042590 | Unclassified | 1029 |
| 217 | Ga0466690_179450 | 3300042590 | Unclassified | 1572 |
| 218 | Ga0466690_244485 | 3300042590 | Bacteria | 1877 |
| 219 | Ga0466690_341481 | 3300042590 | Unclassified | 6723 |
| 220 | Ga0466691_027851 | 3300042593 | Unclassified | 1649 |
| 221 | Ga0466691_109641 | 3300042593 | Bacteria | 14703 |
| 222 | Ga0466696_055934 | 3300042596 | Bacteria | 3976 |
| 223 | Ga0466707_303748 | 3300042601 | Bacteria | 3687 |
| 224 | Ga0466716_466600 | 3300042605 | Unclassified | 1988 |
| 225 | Ga0466719_064942 | 3300042606 | Bacteria | 2721 |
| 226 | Ga0466719_192318 | 3300042606 | Bacteria | 18465 |
| 227 | Ga0466719_269645 | 3300042606 | Bacteria | 1795 |
| 228 | Ga0466719_395000 | 3300042606 | Bacteria | 2405 |
| 229 | Ga0466719_413859 | 3300042606 | Bacteria | 1068 |
| 230 | Ga0466720_001846 | 3300042607 | Bacteria | 12597 |
| 231 | Ga0466722_093362 | 3300042609 | Bacteria | 7068 |
| 232 | Ga0466709_018383 | 3300042648 | Bacteria | 1623 |
| 233 | Ga0466709_031402 | 3300042648 | Unclassified | 11656 |
| 234 | Ga0466709_229798 | 3300042648 | Bacteria | 12445 |
| 235 | Ga0466727_030437 | 3300042655 | Unclassified | 3088 |
| 236 | AustNasuHG_c1025388 | 3300000089 | Bacteria | 1861 |
| 237 | JGI24698J34947_10002307 | 3300002449 | Bacteria | 10249 |
| 238 | JGI24698J34947_10021872 | 3300002449 | Bacteria | 3435 |
| 239 | JGI24698J34947_10248289 | 3300002449 | Bacteria | 666 |
| 240 | JGI24695J34938_10082337 | 3300002450 | Bacteria | 1328 |
| 241 | JGI24699J35502_10884969 | 3300002509 | Bacteria | 1016 |
| 242 | Ga0072941_1009476 | 3300005201 | Bacteria | 25614 |
| 243 | Ga0072941_1029944 | 3300005201 | Unclassified | 3494 |
| 244 | Ga0072941_1046861 | 3300005201 | Bacteria | 13388 |
| 245 | Ga0072941_1065897 | 3300005201 | Bacteria | 14779 |
| 246 | Ga0466705_261523 | 3300042612 | Unclassified | 5358 |
| 247 | Ga0466733_183597 | 3300042659 | Bacteria | 1234 |
| 248 | Ga0466712_294111 | 3300042614 | Unclassified | 1283 |
| 249 | Ga0466723_010426 | 3300042618 | Unclassified | 4621 |
| 250 | Ga0466723_364265 | 3300042618 | Bacteria | 16673 |
| 251 | Ga0466728_157110 | 3300042620 | Bacteria | 1478 |
| 252 | Ga0466728_158306 | 3300042620 | Unclassified | 2269 |
| 253 | Ga0466729_111518 | 3300042621 | Bacteria | 3846 |
| 254 | Ga0123353_10947922 | 3300010167 | Bacteria | 1164 |
| 255 | Ga0123353_11582288 | 3300010167 | Bacteria | 829 |
| 256 | Ga0466694_327873 | 3300042594 | Bacteria | 1083 |
| 257 | Ga0466699_114776 | 3300042597 | Bacteria | 1167 |
| 258 | Ga0466719_062039 | 3300042606 | Bacteria | 13312 |
| 259 | Ga0466719_350153 | 3300042606 | Bacteria | 1361 |
| 260 | Ga0466720_006284 | 3300042607 | Bacteria | 19291 |
| 261 | Ga0466720_195622 | 3300042607 | Bacteria | 2482 |
| 262 | Ga0466735_089300 | 3300042624 | Bacteria | 1455 |
| 263 | Ga0466735_187974 | 3300042624 | Bacteria | 4207 |
| 264 | Ga0466704_117227 | 3300042643 | Bacteria | 1292 |
| 265 | Ga0466709_313864 | 3300042648 | Bacteria | 5636 |
| 266 | JGI24698J34947_10037456 | 3300002449 | Unclassified | 2519 |
| 267 | JGI24700J35501_10926325 | 3300002508 | Bacteria | 6203 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01668 | SmpB | SmpB protein | 25 | 166 | 0.99 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01668 | GO:0003723 | RNA binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.