Protein Family IF00555

Metagenome Isolate
209 Members
43 Samples
205 Scaffolds
83.09 Avg Length

🧬 Representative Sequence

ID
3300002449|JGI24698J34947_10090543|JGI24698J34947_100905432
Length
100 aa
Sequence
MANANDFVINETVDITDVVCPVTFVKAKVALEELDDGQVLCIRLNDGEPVQNVPRSIKEEGHRVLKLADNGDGTYNLIVQKVGEWTSGAETCRQRRRHL*

📊 Sample Types

Isolate 1.9%
Metagenome 98.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 37.5%
Kalotermitidae 27.5%
Unclassified 15.0%
Termopsidae 10.0%
Rhinotermitidae 7.5%
Hodotermitidae 2.5%

🌳 Taxonomy

Archaea 1
Bacteria 188
Eukaryota 0
Viruses 0
Unclassified 20

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
2 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
3 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
4 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
7 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
8 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
9 2030936001 Nasutitermes corniger hindgut microbial communities from Florida, USA Metagenome Termitidae
10 2585428085 Sporobacter termitidis DSM 10068 Isolate Termitidae
11 2778260937 Unclassified Fibrobacteres Co191P3bin40 Isolate Unclassified
12 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
13 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
14 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
15 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
16 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
17 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
18 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
19 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
20 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
21 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
22 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
23 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
24 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
25 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
26 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
27 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
28 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
29 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
30 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
31 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
32 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
33 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
34 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
35 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
36 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
37 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
38 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
39 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
40 2820831444 Unclassified Actinobacteria Nc150P4bin21 Isolate Unclassified
41 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
42 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
43 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_351542 3300042612 Bacteria 6371
2 Ga0466712_025396 3300042614 Bacteria 1235
3 Ga0466712_133447 3300042614 Unclassified 4345
4 Ga0466711_058429 3300042615 Bacteria 7655
5 Ga0466715_287175 3300042616 Bacteria 1164
6 Ga0466718_040236 3300042617 Bacteria 14065
7 Ga0466726_029287 3300042619 Bacteria 1035
8 Ga0466726_329195 3300042619 Bacteria 14116
9 Ga0466707_288430 3300042601 Bacteria 123170
10 Ga0466707_329635 3300042601 Bacteria 27411
11 Ga0466719_393583 3300042606 Bacteria 1877
12 Ga0466722_013641 3300042609 Bacteria 5196
13 Ga0466702_181526 3300042635 Bacteria 2680
14 AustNasuHG_c1000173 3300000089 Bacteria 20878
15 JGI24698J34947_10021237 3300002449 Bacteria 3495
16 Ga0072941_1000707 3300005201 Bacteria 59159
17 Ga0072941_1112483 3300005201 Bacteria 1166
18 Ga0074263_105522 3300005485 Bacteria 2111
19 Ga0264413_102558 3300024493 Bacteria 23699
20 Ga0264413_107082 3300024493 Bacteria 6643
21 Ga0264413_111816 3300024493 Bacteria 2811
22 Ga0466691_060526 3300042593 Bacteria 22735
23 Ga0466699_001442 3300042597 Bacteria 1166
24 Ga0466712_240568 3300042614 Bacteria 13742
25 Ga0466715_292320 3300042616 Bacteria 2041
26 Ga0466715_303085 3300042616 Bacteria 1439
27 Ga0466715_379594 3300042616 Bacteria 10862
28 Ga0466718_066507 3300042617 Bacteria 11746
29 Ga0466723_087582 3300042618 Bacteria 1913
30 Ga0466723_210350 3300042618 Bacteria 3531
31 Ga0466726_181070 3300042619 Bacteria 19828
32 Ga0466726_210937 3300042619 Unclassified 3648
33 Ga0466728_238449 3300042620 Bacteria 4759
34 Ga0466729_045840 3300042621 Bacteria 14348
35 Ga0466720_188165 3300042607 Bacteria 8298
36 Ga0466735_092235 3300042624 Bacteria 1030
37 Ga0466702_354563 3300042635 Unclassified 1951
38 Ga0466702_431579 3300042635 Bacteria 2861
39 Ga0466727_330577 3300042655 Bacteria 1053
40 AustNasuHG_c1073356 3300000089 Bacteria 606
41 FAAS_10342783 3300001880 Unclassified 532
42 JGI24698J34947_10001358 3300002449 Bacteria 12861
43 JGI24698J34947_10020360 3300002449 Bacteria 3573
44 JGI24698J34947_10301988 3300002449 Bacteria 577
45 Ga0068302_10086596 3300005071 Bacteria 1929
46 Ga0072940_1104958 3300005200 Bacteria 2025
47 Ga0072941_1011317 3300005201 Bacteria 25843
48 Ga0466705_239251 3300042612 Bacteria 21654
49 Ga0466732_129340 3300042656 Bacteria 1393
50 Ga0466732_268778 3300042656 Bacteria 10049
51 Ga0466712_272700 3300042614 Bacteria 9083
52 Ga0466711_071817 3300042615 Bacteria 49570
53 Ga0466715_324564 3300042616 Bacteria 17911
54 Ga0466715_602136 3300042616 Bacteria 2944
55 Ga0466726_175080 3300042619 Bacteria 14110
56 Ga0466726_403584 3300042619 Bacteria 37190
57 Ga0466728_244310 3300042620 Bacteria 7469
58 Ga0466706_121160 3300042599 Bacteria 3842
59 Ga0466707_018342 3300042601 Bacteria 15203
60 Ga0466707_189250 3300042601 Bacteria 2536
61 Ga0466719_220589 3300042606 Bacteria 1871
62 Ga0466702_014019 3300042635 Bacteria 3164
63 Ga0466702_172906 3300042635 Bacteria 2077
64 Ga0466704_381590 3300042643 Bacteria 1715
65 Ga0466708_281295 3300042652 Bacteria 2281
66 Ga0466708_306443 3300042652 Bacteria 1076
67 Ga0466708_376435 3300042652 Bacteria 25891
68 Ga0466727_233059 3300042655 Bacteria 1253
69 AustNasuHG_c1033816 3300000089 Unclassified 1383
70 JGI24698J34947_10001022 3300002449 Bacteria 14396
71 JGI24698J34947_10002849 3300002449 Unclassified 9376
72 JGI24698J34947_10004047 3300002449 Bacteria 7963
73 JGI24698J34947_10043974 3300002449 Bacteria 2287
74 Ga0072941_1009272 3300005201 Bacteria 9522
75 Ga0072941_1032629 3300005201 Bacteria 19432
76 Ga0264413_113029 3300024493 Bacteria 5775
77 Ga0466732_316689 3300042656 Unclassified 2221
78 Ga0466712_087523 3300042614 Unclassified 1449
79 Ga0466712_300388 3300042614 Bacteria 31259
80 Ga0466711_133033 3300042615 Unclassified 3221
81 Ga0466715_163484 3300042616 Bacteria 3778
82 Ga0466715_188072 3300042616 Bacteria 7135
83 Ga0466715_259160 3300042616 Bacteria 70754
84 Ga0466715_456493 3300042616 Bacteria 86871
85 Ga0466728_250851 3300042620 Bacteria 3747
86 Ga0466729_099777 3300042621 Bacteria 1223
87 Ga0466707_040282 3300042601 Bacteria 1254
88 Ga0466713_055484 3300042602 Bacteria 81535
89 Ga0466702_169810 3300042635 Bacteria 1607
90 Ga0466703_048113 3300042636 Bacteria 5933
91 Ga0466703_423403 3300042636 Bacteria 132694
92 Ga0466727_298244 3300042655 Bacteria 2576
93 FAAS_10681649 3300001880 Unclassified 507
94 JGI24698J34947_10007060 3300002449 Bacteria 6174
95 JGI24698J34947_10067323 3300002449 Bacteria 1738
96 JGI24698J34947_10090543 3300002449 Bacteria 1405
97 JGI24698J34947_10127129 3300002449 Unclassified 1096
98 JGI24698J34947_10297237 3300002449 Bacteria 583
99 Ga0072940_1025225 3300005200 Bacteria 1103
100 Ga0072941_1020080 3300005201 Bacteria 4904
101 Ga0072941_1079177 3300005201 Bacteria 10481
102 Ga0072941_1105007 3300005201 Unclassified 984
103 Ga0072941_1403584 3300005201 Bacteria 1923
104 Ga0466692_079050 3300042591 Bacteria 1947
105 Ga0466692_167562 3300042591 Bacteria 3204
106 Ga0466705_508585 3300042612 Bacteria 20766
107 Ga0466712_267381 3300042614 Bacteria 4423
108 Ga0466711_151097 3300042615 Bacteria 6758
109 Ga0466711_239978 3300042615 Bacteria 7223
110 Ga0466715_071408 3300042616 Bacteria 25464
111 Ga0466718_041095 3300042617 Bacteria 43589
112 Ga0466726_148960 3300042619 Bacteria 6126
113 Ga0466726_159739 3300042619 Bacteria 2548
114 Ga0466726_415043 3300042619 Bacteria 1249
115 Ga0466707_185430 3300042601 Bacteria 2396
116 Ga0466716_316470 3300042605 Bacteria 1874
117 Ga0466719_409012 3300042606 Bacteria 1609
118 Ga0466735_229785 3300042624 Bacteria 4853
119 Ga0466704_447378 3300042643 Bacteria 1925
120 Ga0466708_287852 3300042652 Bacteria 24112
121 Nasutiter_Contig08825 2030936001 Bacteria 1298
122 JGI24698J34947_10016074 3300002449 Bacteria 4066
123 Ga0068302_10267405 3300005071 Unclassified 845
124 Ga0072940_1025223 3300005200 Bacteria 1705
125 Ga0072940_1096062 3300005200 Bacteria 964
126 Ga0072941_1000049 3300005201 Bacteria 59921
127 Ga0072941_1039869 3300005201 Bacteria 8997
128 Ga0072941_1103963 3300005201 Archaea 1313
129 Ga0074263_108466 3300005485 Bacteria 1254
130 Ga0264413_103743 3300024493 Bacteria 33640
131 Ga0264413_105121 3300024493 Unclassified 2743
132 Ga0466691_081085 3300042593 Bacteria 49973
133 Ga0466712_114365 3300042614 Bacteria 4997
134 Ga0466712_166145 3300042614 Bacteria 7880
135 Ga0466726_110180 3300042619 Bacteria 1196
136 Ga0466713_020958 3300042602 Bacteria 10951
137 Ga0466716_159903 3300042605 Bacteria 10755
138 Ga0466719_197953 3300042606 Bacteria 2732
139 Ga0466720_068143 3300042607 Bacteria 30497
140 Ga0466722_094696 3300042609 Bacteria 68121
141 Ga0466735_099116 3300042624 Unclassified 1096
142 Ga0466702_033581 3300042635 Bacteria 2098
143 Ga0466708_046079 3300042652 Bacteria 7149
144 AustNasuHG_c1021621 3300000089 Bacteria 2080
145 AustNasuHG_c1047814 3300000089 Bacteria 948
146 JGI24698J34947_10012246 3300002449 Bacteria 4704
147 JGI24698J34947_10057013 3300002449 Bacteria 1940
148 JGI24698J34947_10214758 3300002449 Bacteria 743
149 JGI24695J34938_10002294 3300002450 Bacteria 14747
150 JGI24697J35500_10844775 3300002507 Bacteria 752
151 Ga0068305_10351801 3300005083 Bacteria 1174
152 Ga0072940_1025224 3300005200 Bacteria 3986
153 Ga0072941_1032965 3300005201 Bacteria 599
154 Ga0466705_330835 3300042612 Bacteria 6041
155 Ga0466712_006225 3300042614 Unclassified 1047
156 Ga0466712_069512 3300042614 Unclassified 1026
157 Ga0466712_074546 3300042614 Unclassified 1253
158 Ga0466712_243045 3300042614 Bacteria 3201
159 Ga0466711_175380 3300042615 Bacteria 1421
160 Ga0466715_154157 3300042616 Bacteria 2194
161 Ga0466715_368297 3300042616 Bacteria 15219
162 Ga0466715_417624 3300042616 Bacteria 6189
163 Ga0466707_027935 3300042601 Bacteria 35771
164 Ga0466707_337756 3300042601 Bacteria 27033
165 Ga0466707_408029 3300042601 Bacteria 1510
166 Ga0466735_064289 3300042624 Bacteria 1015
167 Ga0466703_252864 3300042636 Bacteria 4697
168 Ga0466727_174833 3300042655 Bacteria 2226
169 AustNasuHG_c1068637 3300000089 Bacteria 648
170 JGI24698J34947_10048214 3300002449 Unclassified 2159
171 JGI24698J34947_10054690 3300002449 Bacteria 1992
172 JGI24699J35502_10747652 3300002509 Bacteria 815
173 Ga0068302_10068892 3300005071 Bacteria 2532
174 Ga0072941_1000282 3300005201 Bacteria 7568
175 Ga0072941_1002041 3300005201 Bacteria 1673
176 Ga0072941_1012004 3300005201 Bacteria 2882
177 Ga0466692_055580 3300042591 Bacteria 8603
178 Ga0466691_063704 3300042593 Bacteria 1098
179 Ga0466732_285037 3300042656 Bacteria 3462
180 Ga0466712_133351 3300042614 Bacteria 20055
181 Ga0466712_134019 3300042614 Bacteria 8204
182 Ga0466712_161739 3300042614 Bacteria 8545
183 Ga0466712_204715 3300042614 Bacteria 1749
184 Ga0466723_058571 3300042618 Bacteria 1741
185 Ga0466726_208904 3300042619 Bacteria 3931
186 Ga0466729_132990 3300042621 Bacteria 1697
187 Ga0466706_120121 3300042599 Bacteria 1389
188 Ga0466716_129157 3300042605 Bacteria 3049
189 Ga0466719_248920 3300042606 Bacteria 2280
190 Ga0466729_210703 3300042621 Bacteria 4761
191 Ga0466702_058331 3300042635 Bacteria 2470
192 Ga0466702_340054 3300042635 Bacteria 1334
193 Ga0466703_332523 3300042636 Bacteria 64032
194 Ga0466708_301383 3300042652 Bacteria 17328
195 Ga0466708_347604 3300042652 Unclassified 20860
196 Ga0466727_015353 3300042655 Bacteria 1113
197 Ga0466727_153474 3300042655 Bacteria 6946
198 Ga0466727_344476 3300042655 Bacteria 1753
199 JGI24698J34947_10000700 3300002449 Bacteria 16398
200 JGI24698J34947_10013379 3300002449 Bacteria 4480
201 JGI24698J34947_10115767 3300002449 Bacteria 1174
202 JGI24698J34947_10286190 3300002449 Bacteria 600
203 Ga0068302_10269568 3300005071 Bacteria 2123
204 Ga0072941_1025430 3300005201 Bacteria 1492
205 Ga0072941_1025431 3300005201 Bacteria 11275

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01206 TusA Sulfurtransferase TusA 11 81 0.97

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.