Protein Family IF00549
Metagenome
Isolate
169
Members
43
Samples
165
Scaffolds
115.51
Avg Length
Representative Sequence
- ID
- 3300002449|JGI24698J34947_10069200|JGI24698J34947_100692004
- Length
- 131 aa
- Sequence
- VLYEGANRSAERRLVMVKGEIWWANLPSDPYGSEPGKRRPVLIIQNDVINRSNIRTVICAVITSNMNQAQVPGNILLEKSITGLDKTSVVNFSQILTVDKTRFIXQVSMLPKNYIAKINESIXYIFNTEL*
Sample Types
Isolate
1.8%
Metagenome
98.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
63.4%
Kalotermitidae
14.6%
Unclassified
9.8%
Termopsidae
7.3%
Rhinotermitidae
4.9%
Taxonomy
Archaea
1
Bacteria
119
Eukaryota
0
Viruses
0
Unclassified
49
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 2 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 3 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 4 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 5 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 6 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 7 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 8 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 9 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 10 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 11 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 12 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 13 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 14 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 15 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 16 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 17 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 18 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 19 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 20 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 21 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 22 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 23 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 24 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 25 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 26 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 27 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 28 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 29 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 30 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 31 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 32 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 33 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 34 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 35 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 36 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 37 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 38 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 39 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 40 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 41 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 42 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 43 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_190400 | 3300042659 | Bacteria | 1125 |
| 2 | Ga0466707_047044 | 3300042601 | Bacteria | 5510 |
| 3 | Ga0466707_422882 | 3300042601 | Bacteria | 2606 |
| 4 | Ga0466698_053977 | 3300042610 | Bacteria | 1542 |
| 5 | Ga0264413_122076 | 3300024493 | Bacteria | 4026 |
| 6 | Ga0466699_131678 | 3300042597 | Unclassified | 2055 |
| 7 | Ga0466702_116890 | 3300042635 | Unclassified | 1152 |
| 8 | Ga0466704_108918 | 3300042643 | Unclassified | 2013 |
| 9 | JGI24698J34947_10033753 | 3300002449 | Unclassified | 2682 |
| 10 | JGI24698J34947_10035972 | 3300002449 | Unclassified | 2581 |
| 11 | JGI24698J34947_10041403 | 3300002449 | Bacteria | 2373 |
| 12 | JGI24698J34947_10086186 | 3300002449 | Unclassified | 1457 |
| 13 | JGI24695J34938_10111190 | 3300002450 | Unclassified | 1116 |
| 14 | Ga0123357_10821229 | 3300009784 | Bacteria | 623 |
| 15 | Ga0466712_047638 | 3300042614 | Bacteria | 1042 |
| 16 | Ga0466712_064046 | 3300042614 | Bacteria | 12680 |
| 17 | Ga0466712_136082 | 3300042614 | Bacteria | 1022 |
| 18 | Ga0466712_194252 | 3300042614 | Bacteria | 20329 |
| 19 | Ga0466718_002113 | 3300042617 | Bacteria | 8982 |
| 20 | Ga0466718_003483 | 3300042617 | Bacteria | 19752 |
| 21 | Ga0466718_066934 | 3300042617 | Bacteria | 4998 |
| 22 | Ga0466728_031947 | 3300042620 | Bacteria | 15463 |
| 23 | Ga0466728_108560 | 3300042620 | Bacteria | 4310 |
| 24 | Ga0466701_099340 | 3300042598 | Bacteria | 1452 |
| 25 | Ga0466707_084250 | 3300042601 | Bacteria | 1281 |
| 26 | Ga0466707_379712 | 3300042601 | Bacteria | 1156 |
| 27 | Ga0466691_038492 | 3300042593 | Bacteria | 1445 |
| 28 | Ga0466694_016490 | 3300042594 | Unclassified | 2378 |
| 29 | Ga0466694_340758 | 3300042594 | Bacteria | 1286 |
| 30 | Ga0466702_128564 | 3300042635 | Bacteria | 2414 |
| 31 | AustNasuHG_c1026205 | 3300000089 | Bacteria | 1819 |
| 32 | JGI24698J34947_10007629 | 3300002449 | Bacteria | 5946 |
| 33 | JGI24698J34947_10015359 | 3300002449 | Bacteria | 4169 |
| 34 | JGI24698J34947_10021268 | 3300002449 | Bacteria | 3492 |
| 35 | JGI24698J34947_10037723 | 3300002449 | Unclassified | 2509 |
| 36 | JGI24698J34947_10074078 | 3300002449 | Unclassified | 1623 |
| 37 | JGI24698J34947_10308154 | 3300002449 | Bacteria | 568 |
| 38 | JGI24699J35502_11121249 | 3300002509 | Bacteria | 3322 |
| 39 | Ga0068302_10955927 | 3300005071 | Bacteria | 574 |
| 40 | Ga0123356_10117740 | 3300010049 | Bacteria | 2578 |
| 41 | Ga0123353_11471689 | 3300010167 | Unclassified | 870 |
| 42 | Ga0466712_033360 | 3300042614 | Unclassified | 1232 |
| 43 | Ga0466712_073520 | 3300042614 | Bacteria | 2649 |
| 44 | Ga0466712_218352 | 3300042614 | Unclassified | 1262 |
| 45 | Ga0466712_250368 | 3300042614 | Unclassified | 1241 |
| 46 | Ga0466718_170498 | 3300042617 | Bacteria | 1199 |
| 47 | Ga0466732_036891 | 3300042656 | Bacteria | 25406 |
| 48 | Ga0466707_233114 | 3300042601 | Bacteria | 6071 |
| 49 | Ga0466720_100850 | 3300042607 | Bacteria | 2639 |
| 50 | Ga0466720_106845 | 3300042607 | Bacteria | 1611 |
| 51 | Ga0466694_100170 | 3300042594 | Bacteria | 6200 |
| 52 | Ga0466694_200709 | 3300042594 | Bacteria | 1032 |
| 53 | Ga0466694_307192 | 3300042594 | Bacteria | 1746 |
| 54 | Ga0466699_252107 | 3300042597 | Bacteria | 1957 |
| 55 | Ga0466699_396870 | 3300042597 | Bacteria | 1285 |
| 56 | Ga0466735_013474 | 3300042624 | Bacteria | 1633 |
| 57 | Ga0466702_352249 | 3300042635 | Bacteria | 13235 |
| 58 | JGI24698J34947_10006816 | 3300002449 | Bacteria | 6276 |
| 59 | JGI24698J34947_10016090 | 3300002449 | Bacteria | 4064 |
| 60 | JGI24698J34947_10077954 | 3300002449 | Unclassified | 1565 |
| 61 | Ga0072941_1007064 | 3300005201 | Bacteria | 31249 |
| 62 | Ga0123355_10001603 | 3300009826 | Bacteria | 31578 |
| 63 | Ga0466712_094954 | 3300042614 | Bacteria | 5978 |
| 64 | Ga0466712_210686 | 3300042614 | Unclassified | 1002 |
| 65 | Ga0466726_138691 | 3300042619 | Bacteria | 1178 |
| 66 | Ga0466726_479098 | 3300042619 | Bacteria | 10124 |
| 67 | Ga0466729_061033 | 3300042621 | Bacteria | 1385 |
| 68 | Ga0466717_221462 | 3300042604 | Bacteria | 1489 |
| 69 | Ga0466720_000773 | 3300042607 | Bacteria | 3595 |
| 70 | Ga0466720_009946 | 3300042607 | Unclassified | 4292 |
| 71 | Ga0466695_275408 | 3300042595 | Bacteria | 1504 |
| 72 | JGI24698J34947_10018757 | 3300002449 | Unclassified | 3735 |
| 73 | JGI24698J34947_10033638 | 3300002449 | Bacteria | 2687 |
| 74 | JGI24698J34947_10126223 | 3300002449 | Unclassified | 1102 |
| 75 | JGI24698J34947_10205655 | 3300002449 | Bacteria | 767 |
| 76 | JGI24697J35500_10919960 | 3300002507 | Bacteria | 832 |
| 77 | Ga0072941_1047383 | 3300005201 | Bacteria | 852 |
| 78 | Ga0072941_1129278 | 3300005201 | Bacteria | 3704 |
| 79 | Ga0072941_1160068 | 3300005201 | Bacteria | 1607 |
| 80 | Ga0123356_11451132 | 3300010049 | Bacteria | 845 |
| 81 | Ga0466712_015700 | 3300042614 | Unclassified | 4696 |
| 82 | Ga0466712_021604 | 3300042614 | Unclassified | 2011 |
| 83 | Ga0466712_075567 | 3300042614 | Unclassified | 1642 |
| 84 | Ga0466712_171182 | 3300042614 | Bacteria | 6572 |
| 85 | Ga0466712_190418 | 3300042614 | Unclassified | 1847 |
| 86 | Ga0466718_043220 | 3300042617 | Unclassified | 1902 |
| 87 | Ga0466718_107737 | 3300042617 | Bacteria | 57891 |
| 88 | Ga0466718_125869 | 3300042617 | Bacteria | 1115 |
| 89 | Ga0466732_131837 | 3300042656 | Bacteria | 3906 |
| 90 | Ga0466732_370702 | 3300042656 | Unclassified | 1817 |
| 91 | Ga0466700_253825 | 3300042600 | Bacteria | 1297 |
| 92 | Ga0466698_442700 | 3300042610 | Unclassified | 1491 |
| 93 | Ga0456237_0000977 | 3300041968 | Bacteria | 4518 |
| 94 | Ga0466693_418615 | 3300042592 | Bacteria | 1165 |
| 95 | Ga0466694_186305 | 3300042594 | Bacteria | 2069 |
| 96 | Ga0466702_081727 | 3300042635 | Bacteria | 1403 |
| 97 | Ga0466702_348773 | 3300042635 | Unclassified | 2962 |
| 98 | JGI24698J34947_10009746 | 3300002449 | Unclassified | 5267 |
| 99 | JGI24698J34947_10013549 | 3300002449 | Unclassified | 4449 |
| 100 | JGI24698J34947_10027816 | 3300002449 | Bacteria | 2999 |
| 101 | JGI24698J34947_10069200 | 3300002449 | Bacteria | 1704 |
| 102 | Ga0072940_1071332 | 3300005200 | Bacteria | 1939 |
| 103 | Ga0072941_1007078 | 3300005201 | Bacteria | 33566 |
| 104 | Ga0466712_077355 | 3300042614 | Unclassified | 7056 |
| 105 | Ga0466712_118025 | 3300042614 | Bacteria | 1233 |
| 106 | Ga0466712_161452 | 3300042614 | Bacteria | 4266 |
| 107 | Ga0466712_319708 | 3300042614 | Archaea | 2800 |
| 108 | Ga0466728_007069 | 3300042620 | Bacteria | 3946 |
| 109 | Ga0466705_118887 | 3300042612 | Bacteria | 1138 |
| 110 | Ga0466733_031419 | 3300042659 | Bacteria | 1595 |
| 111 | Ga0466707_064799 | 3300042601 | Bacteria | 1328 |
| 112 | Ga0466720_063332 | 3300042607 | Bacteria | 12713 |
| 113 | Ga0466720_078651 | 3300042607 | Bacteria | 3558 |
| 114 | Ga0466693_098906 | 3300042592 | Bacteria | 1267 |
| 115 | AustNasuHG_c1002370 | 3300000089 | Bacteria | 6816 |
| 116 | JGI24698J34947_10168102 | 3300002449 | Unclassified | 891 |
| 117 | JGI24698J34947_10294216 | 3300002449 | Bacteria | 588 |
| 118 | JGI24698J34947_10294407 | 3300002449 | Unclassified | 587 |
| 119 | Ga0123353_10143348 | 3300010167 | Bacteria | 3824 |
| 120 | Ga0123354_10216237 | 3300010882 | Bacteria | 2053 |
| 121 | Ga0466712_221365 | 3300042614 | Bacteria | 1966 |
| 122 | Ga0466712_265425 | 3300042614 | Bacteria | 1885 |
| 123 | Ga0466719_305405 | 3300042606 | Bacteria | 1139 |
| 124 | Ga0466720_137454 | 3300042607 | Unclassified | 2601 |
| 125 | Ga0466708_324354 | 3300042652 | Bacteria | 1471 |
| 126 | Ga0466708_421065 | 3300042652 | Unclassified | 8294 |
| 127 | AustNasuHG_c1008514 | 3300000089 | Unclassified | 3630 |
| 128 | AustNasuHG_c1082209 | 3300000089 | Bacteria | 541 |
| 129 | JGI24698J34947_10004636 | 3300002449 | Bacteria | 7493 |
| 130 | JGI24698J34947_10012938 | 3300002449 | Bacteria | 4559 |
| 131 | JGI24698J34947_10087963 | 3300002449 | Unclassified | 1435 |
| 132 | JGI24698J34947_10114611 | 3300002449 | Unclassified | 1182 |
| 133 | JGI24697J35500_10627076 | 3300002507 | Unclassified | 597 |
| 134 | JGI24697J35500_11050682 | 3300002507 | Bacteria | 1039 |
| 135 | JGI24697J35500_11079338 | 3300002507 | Unclassified | 1106 |
| 136 | Ga0123356_10089857 | 3300010049 | Bacteria | 2923 |
| 137 | Ga0123353_10807916 | 3300010167 | Bacteria | 1293 |
| 138 | Ga0466712_098946 | 3300042614 | Unclassified | 2929 |
| 139 | Ga0466718_053917 | 3300042617 | Unclassified | 1127 |
| 140 | Ga0466728_192576 | 3300042620 | Bacteria | 1614 |
| 141 | Ga0466707_119459 | 3300042601 | Bacteria | 2186 |
| 142 | Ga0466720_083580 | 3300042607 | Bacteria | 9507 |
| 143 | Ga0466721_186008 | 3300042608 | Unclassified | 1354 |
| 144 | Ga0264413_106319 | 3300024493 | Bacteria | 3626 |
| 145 | Ga0466694_093579 | 3300042594 | Bacteria | 2022 |
| 146 | Ga0466699_193506 | 3300042597 | Unclassified | 1188 |
| 147 | Ga0466729_278916 | 3300042621 | Bacteria | 1069 |
| 148 | AustNasuHG_c1017872 | 3300000089 | Bacteria | 2349 |
| 149 | JGI24698J34947_10001298 | 3300002449 | Bacteria | 13104 |
| 150 | JGI24698J34947_10006213 | 3300002449 | Bacteria | 6564 |
| 151 | JGI24698J34947_10061451 | 3300002449 | Bacteria | 1849 |
| 152 | JGI24698J34947_10080304 | 3300002449 | Bacteria | 1532 |
| 153 | JGI24698J34947_10269218 | 3300002449 | Unclassified | 628 |
| 154 | JGI24698J34947_10344852 | 3300002449 | Bacteria | 523 |
| 155 | JGI24695J34938_10176870 | 3300002450 | Bacteria | 882 |
| 156 | Ga0072940_1094520 | 3300005200 | Bacteria | 2245 |
| 157 | Ga0123356_10471208 | 3300010049 | Bacteria | 1407 |
| 158 | Ga0123353_10841203 | 3300010167 | Unclassified | 1260 |
| 159 | Ga0466712_027975 | 3300042614 | Unclassified | 3529 |
| 160 | Ga0466712_087598 | 3300042614 | Bacteria | 23738 |
| 161 | Ga0466712_142301 | 3300042614 | Bacteria | 17272 |
| 162 | Ga0466718_036637 | 3300042617 | Bacteria | 2027 |
| 163 | Ga0466718_092601 | 3300042617 | Unclassified | 3018 |
| 164 | Ga0466718_098768 | 3300042617 | Unclassified | 4871 |
| 165 | Ga0466728_107303 | 3300042620 | Unclassified | 2415 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300041968 | Ga0456237_0000977 | Ga0456237_0000977_3843_4184 | 105 |
| 2 | 3300042594 | Ga0466694_186305 | Ga0466694_186305_270_593 | 107 |
| 3 | 3300005201 | Ga0072941_1129278 | Ga0072941_11292784 | 110 |
| 4 | 3300042614 | Ga0466712_073520 | Ga0466712_073520_1302_1634 | 110 |
| 5 | 3300024493 | Ga0264413_106319 | Ga0264413_1063191 | 113 |
| 6 | 3300042597 | Ga0466699_396870 | Ga0466699_396870_792_1133 | 113 |
| 7 | 3300042600 | Ga0466700_253825 | Ga0466700_253825_618_959 | 113 |
| 8 | 3300042601 | Ga0466707_047044 | Ga0466707_047044_3742_4083 | 113 |
| 9 | 3300042601 | Ga0466707_064799 | Ga0466707_064799_743_1084 | 113 |
| 10 | 3300042601 | Ga0466707_084250 | Ga0466707_084250_458_799 | 113 |
| 11 | 3300042601 | Ga0466707_119459 | Ga0466707_119459_1506_1847 | 113 |
| 12 | 3300042601 | Ga0466707_233114 | Ga0466707_233114_1542_1883 | 113 |
| 13 | 3300042601 | Ga0466707_379712 | Ga0466707_379712_210_551 | 113 |
| 14 | 3300042601 | Ga0466707_422882 | Ga0466707_422882_106_447 | 113 |
| 15 | 3300042607 | Ga0466720_063332 | Ga0466720_063332_11329_11670 | 113 |
| 16 | 3300042607 | Ga0466720_083580 | Ga0466720_083580_177_518 | 113 |
| 17 | 3300042610 | Ga0466698_053977 | Ga0466698_053977_537_878 | 113 |
| 18 | 3300042617 | Ga0466718_170498 | Ga0466718_170498_495_836 | 113 |
| 19 | 3300042619 | Ga0466726_138691 | Ga0466726_138691_286_627 | 113 |
| 20 | 3300042619 | Ga0466726_479098 | Ga0466726_479098_218_559 | 113 |
| 21 | 3300042620 | Ga0466728_007069 | Ga0466728_007069_903_1244 | 113 |
| 22 | 3300042620 | Ga0466728_031947 | Ga0466728_031947_11291_11632 | 113 |
| 23 | 3300042620 | Ga0466728_107303 | Ga0466728_107303_1174_1515 | 113 |
| 24 | 3300042620 | Ga0466728_108560 | Ga0466728_108560_2823_3164 | 113 |
| 25 | 3300042620 | Ga0466728_192576 | Ga0466728_192576_543_884 | 113 |
| 26 | 3300042621 | Ga0466729_278916 | Ga0466729_278916_102_443 | 113 |
| 27 | 3300042652 | Ga0466708_324354 | Ga0466708_324354_1000_1341 | 113 |
| 28 | 3300042652 | Ga0466708_421065 | Ga0466708_421065_7823_8164 | 113 |
| 29 | iso_pr_bacteria | 2781125641 | 2781290762 | 113 |
| 30 | iso_pr_bacteria | 2781125682 | 2781409602 | 113 |
| 31 | 3300002450 | JGI24695J34938_10176870 | JGI24695J34938_101768701 | 114 |
| 32 | 3300005071 | Ga0068302_10955927 | Ga0068302_109559271 | 114 |
| 33 | 3300005201 | Ga0072941_1047383 | Ga0072941_10473832 | 114 |
| 34 | 3300010167 | Ga0123353_10807916 | Ga0123353_108079162 | 114 |
| 35 | 3300042607 | Ga0466720_009946 | Ga0466720_009946_472_816 | 114 |
| 36 | 3300042614 | Ga0466712_027975 | Ga0466712_027975_2245_2589 | 114 |
| 37 | 3300042624 | Ga0466735_013474 | Ga0466735_013474_287_631 | 114 |
| 38 | 3300042635 | Ga0466702_348773 | Ga0466702_348773_2166_2510 | 114 |
| 39 | 3300042643 | Ga0466704_108918 | Ga0466704_108918_1437_1781 | 114 |
| 40 | 3300002449 | JGI24698J34947_10037723 | JGI24698J34947_100377231 | 115 |
| 41 | 3300002449 | JGI24698J34947_10086186 | JGI24698J34947_100861862 | 115 |
| 42 | 3300010049 | Ga0123356_10089857 | Ga0123356_100898573 | 115 |
| 43 | 3300010167 | Ga0123353_10143348 | Ga0123353_101433482 | 115 |
| 44 | 3300024493 | Ga0264413_122076 | Ga0264413_1220763 | 115 |
| 45 | 3300042593 | Ga0466691_038492 | Ga0466691_038492_726_1073 | 115 |
| 46 | 3300042594 | Ga0466694_016490 | Ga0466694_016490_135_482 | 115 |
| 47 | 3300042594 | Ga0466694_307192 | Ga0466694_307192_511_858 | 115 |
| 48 | 3300042594 | Ga0466694_340758 | Ga0466694_340758_561_908 | 115 |
| 49 | 3300042595 | Ga0466695_275408 | Ga0466695_275408_507_854 | 115 |
| 50 | 3300042597 | Ga0466699_131678 | Ga0466699_131678_1324_1671 | 115 |
| 51 | 3300042597 | Ga0466699_193506 | Ga0466699_193506_354_701 | 115 |
| 52 | 3300042598 | Ga0466701_099340 | Ga0466701_099340_391_738 | 115 |
| 53 | 3300042604 | Ga0466717_221462 | Ga0466717_221462_265_612 | 115 |
| 54 | 3300042606 | Ga0466719_305405 | Ga0466719_305405_423_770 | 115 |
| 55 | 3300042607 | Ga0466720_000773 | Ga0466720_000773_371_718 | 115 |
| 56 | 3300042607 | Ga0466720_137454 | Ga0466720_137454_1782_2129 | 115 |
| 57 | 3300042608 | Ga0466721_186008 | Ga0466721_186008_759_1106 | 115 |
| 58 | 3300042610 | Ga0466698_442700 | Ga0466698_442700_754_1101 | 115 |
| 59 | 3300042614 | Ga0466712_015700 | Ga0466712_015700_30_377 | 115 |
| 60 | 3300042614 | Ga0466712_033360 | Ga0466712_033360_834_1181 | 115 |
| 61 | 3300042614 | Ga0466712_047638 | Ga0466712_047638_95_442 | 115 |
| 62 | 3300042614 | Ga0466712_064046 | Ga0466712_064046_5304_5651 | 115 |
| 63 | 3300042614 | Ga0466712_075567 | Ga0466712_075567_1155_1502 | 115 |
| 64 | 3300042614 | Ga0466712_077355 | Ga0466712_077355_3488_3835 | 115 |
| 65 | 3300042614 | Ga0466712_098946 | Ga0466712_098946_1917_2264 | 115 |
| 66 | 3300042614 | Ga0466712_118025 | Ga0466712_118025_39_386 | 115 |
| 67 | 3300042614 | Ga0466712_142301 | Ga0466712_142301_16450_16797 | 115 |
| 68 | 3300042614 | Ga0466712_161452 | Ga0466712_161452_2679_3026 | 115 |
| 69 | 3300042614 | Ga0466712_161452 | Ga0466712_161452_88_435 | 115 |
| 70 | 3300042614 | Ga0466712_190418 | Ga0466712_190418_1427_1774 | 115 |
| 71 | 3300042614 | Ga0466712_194252 | Ga0466712_194252_10513_10860 | 115 |
| 72 | 3300042614 | Ga0466712_210686 | Ga0466712_210686_120_467 | 115 |
| 73 | 3300042614 | Ga0466712_221365 | Ga0466712_221365_106_453 | 115 |
| 74 | 3300042614 | Ga0466712_250368 | Ga0466712_250368_714_1061 | 115 |
| 75 | 3300042614 | Ga0466712_265425 | Ga0466712_265425_67_414 | 115 |
| 76 | 3300042614 | Ga0466712_319708 | Ga0466712_319708_1062_1409 | 115 |
| 77 | 3300042617 | Ga0466718_002113 | Ga0466718_002113_126_473 | 115 |
| 78 | 3300042617 | Ga0466718_036637 | Ga0466718_036637_550_897 | 115 |
| 79 | 3300042617 | Ga0466718_066934 | Ga0466718_066934_2191_2538 | 115 |
| 80 | 3300042617 | Ga0466718_107737 | Ga0466718_107737_40715_41062 | 115 |
| 81 | 3300042635 | Ga0466702_116890 | Ga0466702_116890_358_705 | 115 |
| 82 | 3300042656 | Ga0466732_370702 | Ga0466732_370702_1292_1639 | 115 |
| 83 | 3300042659 | Ga0466733_031419 | Ga0466733_031419_1172_1519 | 115 |
| 84 | 3300042659 | Ga0466733_190400 | Ga0466733_190400_339_686 | 115 |
| 85 | iso_pr_bacteria | 2781125655 | 2781317536 | 115 |
| 86 | 3300000089 | AustNasuHG_c1002370 | AustNasuHG_10023706 | 116 |
| 87 | 3300000089 | AustNasuHG_c1008514 | AustNasuHG_10085141 | 116 |
| 88 | 3300000089 | AustNasuHG_c1017872 | AustNasuHG_10178723 | 116 |
| 89 | 3300000089 | AustNasuHG_c1082209 | AustNasuHG_10822092 | 116 |
| 90 | 3300002449 | JGI24698J34947_10001298 | JGI24698J34947_100012986 | 116 |
| 91 | 3300002449 | JGI24698J34947_10004636 | JGI24698J34947_100046368 | 116 |
| 92 | 3300002449 | JGI24698J34947_10006213 | JGI24698J34947_100062135 | 116 |
| 93 | 3300002449 | JGI24698J34947_10006816 | JGI24698J34947_100068165 | 116 |
| 94 | 3300002449 | JGI24698J34947_10007629 | JGI24698J34947_100076297 | 116 |
| 95 | 3300002449 | JGI24698J34947_10009746 | JGI24698J34947_100097465 | 116 |
| 96 | 3300002449 | JGI24698J34947_10012938 | JGI24698J34947_100129384 | 116 |
| 97 | 3300002449 | JGI24698J34947_10016090 | JGI24698J34947_100160906 | 116 |
| 98 | 3300002449 | JGI24698J34947_10018757 | JGI24698J34947_100187572 | 116 |
| 99 | 3300002449 | JGI24698J34947_10027816 | JGI24698J34947_100278163 | 116 |
| 100 | 3300002449 | JGI24698J34947_10033638 | JGI24698J34947_100336382 | 116 |
| 101 | 3300002449 | JGI24698J34947_10035972 | JGI24698J34947_100359722 | 116 |
| 102 | 3300002449 | JGI24698J34947_10041403 | JGI24698J34947_100414032 | 116 |
| 103 | 3300002449 | JGI24698J34947_10061451 | JGI24698J34947_100614513 | 116 |
| 104 | 3300002449 | JGI24698J34947_10087963 | JGI24698J34947_100879632 | 116 |
| 105 | 3300002449 | JGI24698J34947_10114611 | JGI24698J34947_101146112 | 116 |
| 106 | 3300002449 | JGI24698J34947_10126223 | JGI24698J34947_101262233 | 116 |
| 107 | 3300002449 | JGI24698J34947_10168102 | JGI24698J34947_101681021 | 116 |
| 108 | 3300002449 | JGI24698J34947_10205655 | JGI24698J34947_102056551 | 116 |
| 109 | 3300002449 | JGI24698J34947_10294216 | JGI24698J34947_102942161 | 116 |
| 110 | 3300002449 | JGI24698J34947_10344852 | JGI24698J34947_103448521 | 116 |
| 111 | 3300002507 | JGI24697J35500_10627076 | JGI24697J35500_106270761 | 116 |
| 112 | 3300002507 | JGI24697J35500_10919960 | JGI24697J35500_109199601 | 116 |
| 113 | 3300002507 | JGI24697J35500_11050682 | JGI24697J35500_110506822 | 116 |
| 114 | 3300002509 | JGI24699J35502_11121249 | JGI24699J35502_111212492 | 116 |
| 115 | 3300005200 | Ga0072940_1071332 | Ga0072940_10713322 | 116 |
| 116 | 3300005201 | Ga0072941_1160068 | Ga0072941_11600683 | 116 |
| 117 | 3300009784 | Ga0123357_10821229 | Ga0123357_108212292 | 116 |
| 118 | 3300009826 | Ga0123355_10001603 | Ga0123355_1000160318 | 116 |
| 119 | 3300010049 | Ga0123356_10117740 | Ga0123356_101177402 | 116 |
| 120 | 3300010167 | Ga0123353_10841203 | Ga0123353_108412033 | 116 |
| 121 | 3300010167 | Ga0123353_11471689 | Ga0123353_114716892 | 116 |
| 122 | 3300042592 | Ga0466693_418615 | Ga0466693_418615_549_899 | 116 |
| 123 | 3300042594 | Ga0466694_200709 | Ga0466694_200709_44_394 | 116 |
| 124 | 3300042597 | Ga0466699_252107 | Ga0466699_252107_470_820 | 116 |
| 125 | 3300042607 | Ga0466720_078651 | Ga0466720_078651_2936_3286 | 116 |
| 126 | 3300042607 | Ga0466720_100850 | Ga0466720_100850_223_573 | 116 |
| 127 | 3300042614 | Ga0466712_021604 | Ga0466712_021604_126_476 | 116 |
| 128 | 3300042614 | Ga0466712_171182 | Ga0466712_171182_3045_3395 | 116 |
| 129 | 3300042614 | Ga0466712_218352 | Ga0466712_218352_446_796 | 116 |
| 130 | 3300042617 | Ga0466718_092601 | Ga0466718_092601_2478_2828 | 116 |
| 131 | 3300042617 | Ga0466718_125869 | Ga0466718_125869_379_729 | 116 |
| 132 | 3300042635 | Ga0466702_081727 | Ga0466702_081727_280_630 | 116 |
| 133 | 3300042635 | Ga0466702_128564 | Ga0466702_128564_405_755 | 116 |
| 134 | 3300042635 | Ga0466702_352249 | Ga0466702_352249_9286_9636 | 116 |
| 135 | 3300042656 | Ga0466732_036891 | Ga0466732_036891_9664_10014 | 116 |
| 136 | 3300002449 | JGI24698J34947_10013549 | JGI24698J34947_100135495 | 117 |
| 137 | 3300002449 | JGI24698J34947_10015359 | JGI24698J34947_100153592 | 117 |
| 138 | 3300002449 | JGI24698J34947_10033753 | JGI24698J34947_100337534 | 117 |
| 139 | 3300002449 | JGI24698J34947_10269218 | JGI24698J34947_102692181 | 117 |
| 140 | 3300002449 | JGI24698J34947_10294407 | JGI24698J34947_102944071 | 117 |
| 141 | 3300002449 | JGI24698J34947_10308154 | JGI24698J34947_103081541 | 117 |
| 142 | 3300002450 | JGI24695J34938_10111190 | JGI24695J34938_101111903 | 117 |
| 143 | 3300002507 | JGI24697J35500_11079338 | JGI24697J35500_110793382 | 117 |
| 144 | 3300005201 | Ga0072941_1007064 | Ga0072941_100706418 | 117 |
| 145 | 3300005201 | Ga0072941_1007078 | Ga0072941_100707811 | 117 |
| 146 | 3300010049 | Ga0123356_10471208 | Ga0123356_104712082 | 117 |
| 147 | 3300010882 | Ga0123354_10216237 | Ga0123354_102162372 | 117 |
| 148 | 3300042592 | Ga0466693_098906 | Ga0466693_098906_201_554 | 117 |
| 149 | 3300042594 | Ga0466694_093579 | Ga0466694_093579_1166_1519 | 117 |
| 150 | 3300042614 | Ga0466712_136082 | Ga0466712_136082_302_655 | 117 |
| 151 | 3300042617 | Ga0466718_043220 | Ga0466718_043220_557_910 | 117 |
| 152 | 3300042617 | Ga0466718_053917 | Ga0466718_053917_231_584 | 117 |
| 153 | 3300010049 | Ga0123356_11451132 | Ga0123356_114511322 | 118 |
| 154 | 3300042594 | Ga0466694_100170 | Ga0466694_100170_4216_4572 | 118 |
| 155 | 3300042607 | Ga0466720_106845 | Ga0466720_106845_328_684 | 118 |
| 156 | 3300042614 | Ga0466712_087598 | Ga0466712_087598_12395_12751 | 118 |
| 157 | 3300042614 | Ga0466712_094954 | Ga0466712_094954_3383_3739 | 118 |
| 158 | 3300042617 | Ga0466718_003483 | Ga0466718_003483_16705_17061 | 118 |
| 159 | 3300042617 | Ga0466718_098768 | Ga0466718_098768_1273_1629 | 118 |
| 160 | 3300000089 | AustNasuHG_c1026205 | AustNasuHG_10262053 | 119 |
| 161 | 3300002449 | JGI24698J34947_10021268 | JGI24698J34947_100212687 | 119 |
| 162 | 3300002449 | JGI24698J34947_10074078 | JGI24698J34947_100740782 | 119 |
| 163 | 3300002449 | JGI24698J34947_10077954 | JGI24698J34947_100779543 | 119 |
| 164 | 3300002449 | JGI24698J34947_10080304 | JGI24698J34947_100803042 | 119 |
| 165 | 3300042612 | Ga0466705_118887 | Ga0466705_118887_669_1028 | 119 |
| 166 | 3300005200 | Ga0072940_1094520 | Ga0072940_10945202 | 122 |
| 167 | 3300042621 | Ga0466729_061033 | Ga0466729_061033_34_414 | 126 |
| 168 | 3300042656 | Ga0466732_131837 | Ga0466732_131837_3473_3859 | 128 |
| 169 | 3300002449 | JGI24698J34947_10069200 | JGI24698J34947_100692004 | 131 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02452 | PemK_toxin | PemK-like, MazF-like toxin of type II toxin-antitoxin system | 18 | 125 | 0.89 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02452 | GO:0003677 | DNA binding | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.79 | 0.84 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.