Protein Family IF00527
Metagenome
Isolate
158
Members
40
Samples
148
Scaffolds
426.63
Avg Length
Representative Sequence
- ID
- 3300002449|JGI24698J34947_10034462|JGI24698J34947_100344621
- Length
- 434 aa
- Sequence
- LIKTVIMAGGKGTRVSSIAADIPKPMIPICGKPILEYQIDCLKENGLTEIILVIGHLGQYIKEHFGDGSRFGCKISYFTETEPLGTAGALYKLKNLSDDFILLNGDVIFDIDFSRMINFHKEKNASVTLAVHPNSHPFDSALIISDKKNQVTGWLNKEDERTLYKNQVNAGVHILSTEFVKDCPQSWPRALEKIDLDRDMLKPSISSGKIFAYSTPEYIKDMGTPERYAQVTSDIEKGIVHGKNLHEKQKCVFLDRDGTINVLIENDFVTKPEQLELIDGAADAVKKINGMGYLAVVITNQPVIARGEVDFQTLDLIHMKMETELGKQGAYIDDLFYCPHHPDKGFEGERPEYKIECDCRKPKPGMILNAAEKYNIDLAQSYMAGDNKRDVQAGINAGCRPVFITNGSEENKESISDLDVQVFSSLKEFADSL*
Sample Types
Isolate
6.3%
Metagenome
93.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
52.6%
Unclassified
23.7%
Kalotermitidae
21.1%
Rhinotermitidae
2.6%
Taxonomy
Archaea
1
Bacteria
148
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 2 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 9 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 10 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 11 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 12 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 13 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 14 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 15 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 16 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 17 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 18 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 19 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 20 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 21 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 22 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 23 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 24 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 25 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 26 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 27 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 28 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 29 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 30 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 31 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 32 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 33 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 34 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 35 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 36 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 37 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 38 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 39 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 40 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466720_028491 | 3300042607 | Bacteria | 76920 |
| 2 | Ga0466720_034980 | 3300042607 | Bacteria | 11699 |
| 3 | Ga0264413_102394 | 3300024493 | Bacteria | 14440 |
| 4 | Ga0264413_128292 | 3300024493 | Bacteria | 8444 |
| 5 | Ga0466699_084084 | 3300042597 | Bacteria | 21187 |
| 6 | Ga0466702_228375 | 3300042635 | Bacteria | 4927 |
| 7 | Ga0466712_137042 | 3300042614 | Bacteria | 2928 |
| 8 | Ga0466718_022853 | 3300042617 | Bacteria | 49734 |
| 9 | Ga0123355_10000659 | 3300009826 | Bacteria | 46817 |
| 10 | JGI24698J34947_10000169 | 3300002449 | Bacteria | 25304 |
| 11 | JGI24698J34947_10029390 | 3300002449 | Unclassified | 2903 |
| 12 | JGI24695J34938_10000255 | 3300002450 | Bacteria | 51460 |
| 13 | Ga0072941_1003147 | 3300005201 | Bacteria | 83880 |
| 14 | Ga0072941_1032822 | 3300005201 | Bacteria | 4587 |
| 15 | Ga0466732_446948 | 3300042656 | Bacteria | 2120 |
| 16 | Ga0466720_036827 | 3300042607 | Bacteria | 40262 |
| 17 | Ga0466720_044049 | 3300042607 | Bacteria | 14732 |
| 18 | Ga0466694_038629 | 3300042594 | Bacteria | 6145 |
| 19 | Ga0466694_342275 | 3300042594 | Bacteria | 17413 |
| 20 | Ga0466699_088664 | 3300042597 | Bacteria | 4000 |
| 21 | Ga0466699_157175 | 3300042597 | Bacteria | 55178 |
| 22 | Ga0466699_206802 | 3300042597 | Bacteria | 5900 |
| 23 | Ga0466699_399268 | 3300042597 | Bacteria | 3795 |
| 24 | Ga0466731_382629 | 3300042622 | Bacteria | 1509 |
| 25 | Ga0466712_066823 | 3300042614 | Bacteria | 4785 |
| 26 | Ga0466712_307642 | 3300042614 | Bacteria | 17229 |
| 27 | Ga0123356_10020788 | 3300010049 | Bacteria | 6207 |
| 28 | AustNasuHG_c1000328 | 3300000089 | Bacteria | 16453 |
| 29 | JGI24698J34947_10016288 | 3300002449 | Bacteria | 4035 |
| 30 | JGI24695J34938_10000122 | 3300002450 | Bacteria | 69892 |
| 31 | JGI24695J34938_10002703 | 3300002450 | Bacteria | 13141 |
| 32 | Ga0072941_1034143 | 3300005201 | Bacteria | 9043 |
| 33 | Ga0466705_266113 | 3300042612 | Bacteria | 67009 |
| 34 | Ga0466720_041453 | 3300042607 | Bacteria | 36391 |
| 35 | Ga0466720_082328 | 3300042607 | Bacteria | 18267 |
| 36 | Ga0466720_128273 | 3300042607 | Bacteria | 13102 |
| 37 | Ga0466720_238860 | 3300042607 | Bacteria | 102895 |
| 38 | Ga0466699_100233 | 3300042597 | Unclassified | 8067 |
| 39 | Ga0466702_463406 | 3300042635 | Bacteria | 8486 |
| 40 | Ga0466712_014319 | 3300042614 | Bacteria | 13934 |
| 41 | Ga0466712_026751 | 3300042614 | Bacteria | 9778 |
| 42 | Ga0466712_077826 | 3300042614 | Bacteria | 33172 |
| 43 | Ga0466718_082780 | 3300042617 | Bacteria | 2828 |
| 44 | Ga0466718_140692 | 3300042617 | Bacteria | 6103 |
| 45 | Ga0466723_031805 | 3300042618 | Bacteria | 21552 |
| 46 | Ga0123355_10048472 | 3300009826 | Bacteria | 6907 |
| 47 | Ga0123356_10003418 | 3300010049 | Bacteria | 16637 |
| 48 | JGI24698J34947_10003870 | 3300002449 | Bacteria | 8136 |
| 49 | JGI24698J34947_10010889 | 3300002449 | Archaea | 4989 |
| 50 | JGI24698J34947_10024905 | 3300002449 | Bacteria | 3189 |
| 51 | JGI24695J34938_10000029 | 3300002450 | Bacteria | 107147 |
| 52 | JGI24695J34938_10010711 | 3300002450 | Bacteria | 4995 |
| 53 | Ga0072941_1004397 | 3300005201 | Bacteria | 9465 |
| 54 | Ga0466732_307709 | 3300042656 | Bacteria | 3559 |
| 55 | Ga0466720_169943 | 3300042607 | Bacteria | 7517 |
| 56 | Ga0264413_112835 | 3300024493 | Bacteria | 3977 |
| 57 | Ga0466693_004946 | 3300042592 | Unclassified | 3689 |
| 58 | Ga0466699_056616 | 3300042597 | Bacteria | 2196 |
| 59 | Ga0466703_429029 | 3300042636 | Bacteria | 1582 |
| 60 | Ga0466718_007341 | 3300042617 | Bacteria | 9888 |
| 61 | JGI24698J34947_10060446 | 3300002449 | Bacteria | 1869 |
| 62 | JGI24695J34938_10000006 | 3300002450 | Bacteria | 141807 |
| 63 | JGI24695J34938_10000511 | 3300002450 | Bacteria | 37801 |
| 64 | JGI24695J34938_10002050 | 3300002450 | Bacteria | 15900 |
| 65 | JGI24695J34938_10003860 | 3300002450 | Bacteria | 10159 |
| 66 | JGI24695J34938_10007305 | 3300002450 | Bacteria | 6496 |
| 67 | JGI24695J34938_10007984 | 3300002450 | Bacteria | 6105 |
| 68 | JGI24702J35022_10000136 | 3300002462 | Bacteria | 36676 |
| 69 | Ga0072941_1024485 | 3300005201 | Bacteria | 5680 |
| 70 | Ga0466732_059780 | 3300042656 | Bacteria | 2074 |
| 71 | Ga0466732_158373 | 3300042656 | Bacteria | 1944 |
| 72 | Ga0466732_300662 | 3300042656 | Bacteria | 5373 |
| 73 | Ga0466720_012479 | 3300042607 | Bacteria | 4131 |
| 74 | Ga0466720_053461 | 3300042607 | Bacteria | 4721 |
| 75 | Ga0264413_104613 | 3300024493 | Unclassified | 5668 |
| 76 | Ga0466699_284753 | 3300042597 | Bacteria | 16017 |
| 77 | Ga0466699_357880 | 3300042597 | Bacteria | 4020 |
| 78 | Ga0466702_452913 | 3300042635 | Bacteria | 12518 |
| 79 | Ga0466712_041086 | 3300042614 | Bacteria | 62732 |
| 80 | Ga0466712_103645 | 3300042614 | Bacteria | 4621 |
| 81 | Ga0466712_106542 | 3300042614 | Bacteria | 17763 |
| 82 | Ga0466718_084538 | 3300042617 | Bacteria | 33255 |
| 83 | Ga0466728_331738 | 3300042620 | Bacteria | 6027 |
| 84 | JGI24698J34947_10034462 | 3300002449 | Bacteria | 2649 |
| 85 | JGI24698J34947_10043080 | 3300002449 | Unclassified | 2315 |
| 86 | JGI24695J34938_10001835 | 3300002450 | Bacteria | 17308 |
| 87 | JGI24695J34938_10036924 | 3300002450 | Bacteria | 2224 |
| 88 | Ga0072941_1002596 | 3300005201 | Bacteria | 9297 |
| 89 | Ga0072941_1003149 | 3300005201 | Bacteria | 7936 |
| 90 | Ga0072941_1121152 | 3300005201 | Bacteria | 3874 |
| 91 | Ga0466732_107553 | 3300042656 | Bacteria | 1931 |
| 92 | Ga0466732_277575 | 3300042656 | Unclassified | 1866 |
| 93 | Ga0466717_029735 | 3300042604 | Bacteria | 2607 |
| 94 | Ga0466720_007381 | 3300042607 | Bacteria | 2375 |
| 95 | Ga0466720_013468 | 3300042607 | Bacteria | 13046 |
| 96 | Ga0466720_112435 | 3300042607 | Bacteria | 45324 |
| 97 | Ga0466720_115267 | 3300042607 | Bacteria | 12481 |
| 98 | Ga0466720_145662 | 3300042607 | Bacteria | 157622 |
| 99 | Ga0264413_105700 | 3300024493 | Bacteria | 9637 |
| 100 | Ga0415639_122675 | 3300038395 | Bacteria | 2647 |
| 101 | Ga0466731_009260 | 3300042622 | Bacteria | 3332 |
| 102 | Ga0466712_067884 | 3300042614 | Bacteria | 8127 |
| 103 | Ga0466712_124747 | 3300042614 | Bacteria | 9450 |
| 104 | Ga0466715_177662 | 3300042616 | Bacteria | 9017 |
| 105 | Ga0466718_051412 | 3300042617 | Bacteria | 10135 |
| 106 | Ga0466718_102641 | 3300042617 | Unclassified | 11969 |
| 107 | Ga0466718_161927 | 3300042617 | Bacteria | 3740 |
| 108 | Ga0123356_10000085 | 3300010049 | Bacteria | 98249 |
| 109 | JGI24695J34938_10000619 | 3300002450 | Bacteria | 33872 |
| 110 | JGI24695J34938_10005247 | 3300002450 | Bacteria | 8167 |
| 111 | JGI24695J34938_10008426 | 3300002450 | Bacteria | 5879 |
| 112 | Ga0074263_109029 | 3300005485 | Bacteria | 1473 |
| 113 | Ga0466732_210587 | 3300042656 | Bacteria | 4658 |
| 114 | Ga0466720_226943 | 3300042607 | Bacteria | 3777 |
| 115 | Ga0466691_058363 | 3300042593 | Bacteria | 17021 |
| 116 | Ga0466699_315145 | 3300042597 | Bacteria | 5242 |
| 117 | Ga0466704_140178 | 3300042643 | Bacteria | 60046 |
| 118 | Ga0466712_030357 | 3300042614 | Bacteria | 33145 |
| 119 | Ga0466711_124600 | 3300042615 | Bacteria | 33924 |
| 120 | Ga0466715_011664 | 3300042616 | Bacteria | 6679 |
| 121 | Ga0466718_036685 | 3300042617 | Bacteria | 20442 |
| 122 | Ga0123356_10107632 | 3300010049 | Bacteria | 2686 |
| 123 | AustNasuHG_c1005727 | 3300000089 | Bacteria | 4439 |
| 124 | JGI24698J34947_10000174 | 3300002449 | Bacteria | 25056 |
| 125 | JGI24698J34947_10000182 | 3300002449 | Bacteria | 24912 |
| 126 | JGI24695J34938_10000104 | 3300002450 | Bacteria | 74204 |
| 127 | Ga0072940_1003256 | 3300005200 | Bacteria | 18993 |
| 128 | Ga0072941_1038770 | 3300005201 | Bacteria | 8362 |
| 129 | Ga0466700_048910 | 3300042600 | Unclassified | 2288 |
| 130 | Ga0466720_099020 | 3300042607 | Bacteria | 25644 |
| 131 | Ga0466720_211375 | 3300042607 | Bacteria | 60841 |
| 132 | Ga0466722_183459 | 3300042609 | Bacteria | 12396 |
| 133 | Ga0264413_102590 | 3300024493 | Unclassified | 13874 |
| 134 | Ga0264413_112834 | 3300024493 | Bacteria | 8149 |
| 135 | Ga0415639_065157 | 3300038395 | Bacteria | 5514 |
| 136 | Ga0466694_125782 | 3300042594 | Bacteria | 25946 |
| 137 | Ga0466699_047467 | 3300042597 | Bacteria | 11573 |
| 138 | Ga0466699_102883 | 3300042597 | Bacteria | 16516 |
| 139 | Ga0466699_406412 | 3300042597 | Bacteria | 5995 |
| 140 | Ga0466718_169172 | 3300042617 | Bacteria | 6779 |
| 141 | AustNasuHG_c1002580 | 3300000089 | Bacteria | 6540 |
| 142 | JGI24698J34947_10000364 | 3300002449 | Bacteria | 20304 |
| 143 | JGI24698J34947_10015001 | 3300002449 | Bacteria | 4219 |
| 144 | JGI24698J34947_10025566 | 3300002449 | Bacteria | 3143 |
| 145 | JGI24695J34938_10000004 | 3300002450 | Bacteria | 163071 |
| 146 | JGI24695J34938_10000031 | 3300002450 | Bacteria | 105176 |
| 147 | JGI24695J34938_10002082 | 3300002450 | Bacteria | 15690 |
| 148 | Ga0072941_1156636 | 3300005201 | Bacteria | 2252 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13419 | HAD_2 | Haloacid dehalogenase-like hydrolase | 360 | 402 | 0.92 |
| PF00483 | NTP_transferase | Nucleotidyl transferase | 3 | 237 | 0.91 |
| PF13242 | Hydrolase_like | HAD-hyrolase-like | 359 | 413 | 0.87 |
| PF00702 | Hydrolase | haloacid dehalogenase-like hydrolase | 246 | 398 | 0.76 |
| PF12804 | NTP_transf_3 | MobA-like NTP transferase domain | 5 | 164 | 0.73 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00483 | GO:0009058 | biosynthetic process | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.