Protein Family IF00521
Metagenome
Metatranscriptome
Isolate
263
Members
89
Samples
227
Scaffolds
567.38
Avg Length
Representative Sequence
- ID
- 3300002449|JGI24698J34947_10029738|JGI24698J34947_100297382
- Length
- 590 aa
- Sequence
- MQRLSPDCASTVSDSFFFSGMKLNGKVAAPGAAVGRIYIYKKNFNLPVESFVGEGEEQSQLDRYFLVKKQAIDXLEKXXISVHKHDKKKADIFKAHQEIVDDIIINEEIPARILNERWAGDWAIYQVYETVILVLRQSADPRVSERAADFDDVRSLLLRLWYGSKSSNLTCPPQPAIIAAGDLLPTDTAGLDKENVLAILTEKGGITSHTAIIARSYGIPTVLGIEGLLAIVKHGQLAAVDADEGTVFIEPDEKIVSEYTERSAAFFRDRQEANAFLKSEGLTADGVKIDIGLNIGESEHELEAQQYADSAGLFRTEFLYMGRKTLPSEEEQFSVYRKTLAAFGKKPVILRTLDIGGDKKLSSIDLPKEENPFLGNRAIRLCFSRPDIFKTQIRAALRASVYGNLWLMLPMVGSLDDIRRAKELIAAAGAELKKEGRQFAEVKTGIMIEIPSIALIADLAAKEVDFASIGSNDLCQYLCAADRMNIGVEEYYQSCHPAMWRLINHVAASFTKAGKPLSVCGELGGDPLTVPVLIGLGLRKLSMGEASIAVVKRAIASLTVKACEEKAKKVLTLSTAAEVREYLSNNIIG*
Sample Types
Isolate
13.7%
Metagenome
85.2%
MAG
0.0%
Metatranscriptome
1.1%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
34.5%
Termitidae
25.3%
Kalotermitidae
14.9%
Tenebrionidae
10.3%
Culicidae
4.6%
Rhinotermitidae
3.4%
Passalidae
1.1%
Apidae
1.1%
Vespidae
1.1%
Hormaphididae
1.1%
Termopsidae
1.1%
Chrysomelidae
1.1%
Taxonomy
Archaea
1
Bacteria
227
Eukaryota
0
Viruses
1
Unclassified
34
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8118997823 | Spiroplasma platyhelix PALS-1 | Isolate | Unclassified |
| 2 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 3 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 4 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 5 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 6 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 7 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 8 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 9 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 10 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 11 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 12 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 13 | 2554235383 | Spiroplasma diminutum CUAS-1 | Isolate | Culicidae |
| 14 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 15 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 16 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 17 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 18 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 19 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 20 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 21 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 22 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 23 | 2561511192 | Spiroplasma taiwanense CT-1 | Isolate | Culicidae |
| 24 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 25 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 26 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 27 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 28 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 29 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 30 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 31 | 2558860238 | Spiroplasma sabaudiense Ar-1343 | Isolate | Culicidae |
| 32 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 33 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 34 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 35 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 36 | 3300060758 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_PS_b (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 37 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 38 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 39 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 40 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 41 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 42 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 43 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 44 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 45 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 46 | 2791355053 | Spiroplasma monobiae MQ-1 | Isolate | Vespidae |
| 47 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 48 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 49 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 50 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 51 | 3300060701 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_PP_c (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 52 | 3300060704 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_PP_oats_c (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 53 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 54 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 55 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 56 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 57 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 58 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 59 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 60 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 61 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 62 | 3002300227 | Buchnera aphidicola (Nipponaphis monzeni) Nmo | Isolate | Hormaphididae |
| 63 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 64 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 65 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 66 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 67 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 68 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 69 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 70 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 71 | 2989426036 | Spiroplasma platyhelix PALS-1 | Isolate | Unclassified |
| 72 | 2558860239 | Spiroplasma culicicola AES-1 | Isolate | Culicidae |
| 73 | 2563366575 | Spiroplasma apis B31 | Isolate | Unclassified |
| 74 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 75 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 76 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 77 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 78 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 79 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 80 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 81 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 82 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 83 | 2998832060 | Enterobacteriaceae endosymbiont of Donacia proxima DproxSym | Isolate | Chrysomelidae |
| 84 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 85 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 86 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 87 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 88 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 89 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562378_0360 | 3300056814 | Unclassified | 88460 |
| 2 | Ga0562378_0713 | 3300056814 | Unclassified | 47852 |
| 3 | Ga0562375_2498 | 3300056856 | Unclassified | 20382 |
| 4 | Ga0562376_1290 | 3300056857 | Unclassified | 36096 |
| 5 | Ga0123356_10000340 | 3300010049 | Bacteria | 53881 |
| 6 | Ga0123356_10001432 | 3300010049 | Bacteria | 26388 |
| 7 | Ga0123356_10008149 | 3300010049 | Unclassified | 10431 |
| 8 | Ga0123356_10014673 | 3300010049 | Bacteria | 7529 |
| 9 | Ga0264413_101302 | 3300024493 | Bacteria | 8738 |
| 10 | Ga0466731_134725 | 3300042622 | Bacteria | 3697 |
| 11 | Ga0466702_020931 | 3300042635 | Bacteria | 8931 |
| 12 | Ga0466702_123183 | 3300042635 | Bacteria | 9423 |
| 13 | Ga0466703_273517 | 3300042636 | Bacteria | 4028 |
| 14 | JGI24698J34947_10000431 | 3300002449 | Bacteria | 19275 |
| 15 | JGI24698J34947_10012317 | 3300002449 | Bacteria | 4687 |
| 16 | JGI24698J34947_10044686 | 3300002449 | Bacteria | 2265 |
| 17 | JGI24695J34938_10000389 | 3300002450 | Bacteria | 43422 |
| 18 | JGI24695J34938_10002524 | 3300002450 | Bacteria | 13864 |
| 19 | Ga0072940_1021456 | 3300005200 | Bacteria | 20392 |
| 20 | Ga0466712_148519 | 3300042614 | Bacteria | 7403 |
| 21 | Ga0466712_176072 | 3300042614 | Bacteria | 26085 |
| 22 | Ga0466711_278247 | 3300042615 | Bacteria | 26787 |
| 23 | Ga0466715_390624 | 3300042616 | Bacteria | 11765 |
| 24 | Ga0466718_018769 | 3300042617 | Bacteria | 8038 |
| 25 | Ga0466718_065218 | 3300042617 | Bacteria | 4449 |
| 26 | Ga0466718_068815 | 3300042617 | Bacteria | 2131 |
| 27 | Ga0466718_097411 | 3300042617 | Viruses | 3699 |
| 28 | Ga0466723_098488 | 3300042618 | Bacteria | 13331 |
| 29 | Ga0466721_102511 | 3300042608 | Bacteria | 6212 |
| 30 | Ga0562379_2159 | 3300056790 | Unclassified | 17635 |
| 31 | Ga0562376_1505 | 3300056857 | Unclassified | 32261 |
| 32 | Ga0562374_0368 | 3300057007 | Unclassified | 83380 |
| 33 | Ga0123356_10000079 | 3300010049 | Bacteria | 103173 |
| 34 | Ga0415639_024687 | 3300038395 | Bacteria | 6844 |
| 35 | Ga0466693_121705 | 3300042592 | Bacteria | 24410 |
| 36 | Ga0466694_051780 | 3300042594 | Bacteria | 5428 |
| 37 | Ga0466694_236252 | 3300042594 | Bacteria | 11024 |
| 38 | Ga0466694_331835 | 3300042594 | Bacteria | 2939 |
| 39 | Ga0466702_110136 | 3300042635 | Bacteria | 6157 |
| 40 | Ga0466708_069710 | 3300042652 | Bacteria | 10053 |
| 41 | JGI24702J35022_10024377 | 3300002462 | Bacteria | 3270 |
| 42 | Ga0068305_10082051 | 3300005083 | Bacteria | 8285 |
| 43 | Ga0072941_1003814 | 3300005201 | Bacteria | 13358 |
| 44 | Ga0072941_1065781 | 3300005201 | Bacteria | 6255 |
| 45 | Ga0466712_019586 | 3300042614 | Bacteria | 4130 |
| 46 | Ga0466712_039754 | 3300042614 | Bacteria | 6530 |
| 47 | Ga0466712_210893 | 3300042614 | Bacteria | 3300 |
| 48 | Ga0466712_299391 | 3300042614 | Bacteria | 27724 |
| 49 | Ga0466711_052740 | 3300042615 | Bacteria | 2293 |
| 50 | Ga0466718_069328 | 3300042617 | Bacteria | 45967 |
| 51 | Ga0466718_111319 | 3300042617 | Bacteria | 2087 |
| 52 | Ga0466718_146517 | 3300042617 | Bacteria | 2767 |
| 53 | Ga0466718_168474 | 3300042617 | Bacteria | 5238 |
| 54 | Ga0466728_132013 | 3300042620 | Bacteria | 3096 |
| 55 | Ga0466716_058240 | 3300042605 | Bacteria | 8732 |
| 56 | Ga0466720_026908 | 3300042607 | Bacteria | 32753 |
| 57 | Ga0466720_044902 | 3300042607 | Bacteria | 6320 |
| 58 | Ga0466720_073592 | 3300042607 | Bacteria | 36208 |
| 59 | Ga0466732_099703 | 3300042656 | Bacteria | 3755 |
| 60 | Ga0466732_299089 | 3300042656 | Bacteria | 51902 |
| 61 | Ga0562379_3510 | 3300056790 | Unclassified | 10111 |
| 62 | Ga0562378_3609 | 3300056814 | Unclassified | 8728 |
| 63 | Ga0562376_0009 | 3300056857 | Bacteria | 1013235 |
| 64 | Ga0562376_3691 | 3300056857 | Unclassified | 14780 |
| 65 | Ga0123355_10008558 | 3300009826 | Bacteria | 15458 |
| 66 | Ga0123356_10000512 | 3300010049 | Bacteria | 43209 |
| 67 | Ga0123356_10006211 | 3300010049 | Bacteria | 12081 |
| 68 | Ga0123356_10031859 | 3300010049 | Bacteria | 4933 |
| 69 | Ga0415639_029150 | 3300038395 | Bacteria | 2557 |
| 70 | Ga0466692_071937 | 3300042591 | Bacteria | 4920 |
| 71 | Ga0466694_365203 | 3300042594 | Bacteria | 39783 |
| 72 | Ga0466695_315985 | 3300042595 | Bacteria | 38906 |
| 73 | Ga0466696_013557 | 3300042596 | Bacteria | 3563 |
| 74 | Ga0466703_040354 | 3300042636 | Bacteria | 25570 |
| 75 | 2227666268 | 2225789004 | Bacteria | 10397 |
| 76 | JGI24698J34947_10000304 | 3300002449 | Bacteria | 21529 |
| 77 | JGI24698J34947_10007323 | 3300002449 | Bacteria | 6064 |
| 78 | JGI24698J34947_10011624 | 3300002449 | Bacteria | 4832 |
| 79 | JGI24698J34947_10047320 | 3300002449 | Bacteria | 2183 |
| 80 | JGI24695J34938_10000129 | 3300002450 | Bacteria | 68011 |
| 81 | JGI24695J34938_10000749 | 3300002450 | Bacteria | 30507 |
| 82 | JGI24695J34938_10003835 | 3300002450 | Archaea | 10207 |
| 83 | Ga0072940_1011136 | 3300005200 | Bacteria | 6250 |
| 84 | Ga0072941_1002871 | 3300005201 | Bacteria | 36049 |
| 85 | Ga0466712_056807 | 3300042614 | Bacteria | 31023 |
| 86 | Ga0466715_572420 | 3300042616 | Bacteria | 103400 |
| 87 | Ga0466718_041952 | 3300042617 | Unclassified | 2061 |
| 88 | Ga0466728_316738 | 3300042620 | Bacteria | 11290 |
| 89 | Ga0466719_295056 | 3300042606 | Bacteria | 6755 |
| 90 | Ga0466719_548595 | 3300042606 | Bacteria | 5618 |
| 91 | Ga0466720_078091 | 3300042607 | Bacteria | 5708 |
| 92 | Ga0562379_3891 | 3300056790 | Unclassified | 8774 |
| 93 | Ga0562378_2290 | 3300056814 | Unclassified | 16545 |
| 94 | Ga0562375_0997 | 3300056856 | Unclassified | 45016 |
| 95 | Ga0466702_086874 | 3300042635 | Bacteria | 5054 |
| 96 | Ga0466702_287467 | 3300042635 | Bacteria | 10468 |
| 97 | Ga0466703_033500 | 3300042636 | Bacteria | 10197 |
| 98 | Ga0466708_404354 | 3300042652 | Bacteria | 7632 |
| 99 | JGI24698J34947_10003971 | 3300002449 | Bacteria | 8046 |
| 100 | JGI24698J34947_10023399 | 3300002449 | Unclassified | 3306 |
| 101 | JGI24698J34947_10028382 | 3300002449 | Bacteria | 2963 |
| 102 | JGI24695J34938_10000063 | 3300002450 | Bacteria | 87942 |
| 103 | JGI24695J34938_10000132 | 3300002450 | Bacteria | 67814 |
| 104 | JGI24695J34938_10002694 | 3300002450 | Bacteria | 13199 |
| 105 | JGI24695J34938_10006030 | 3300002450 | Bacteria | 7395 |
| 106 | JGI24695J34938_10021258 | 3300002450 | Bacteria | 3177 |
| 107 | Ga0466712_008276 | 3300042614 | Bacteria | 3014 |
| 108 | Ga0466712_014889 | 3300042614 | Bacteria | 58641 |
| 109 | Ga0466712_124392 | 3300042614 | Unclassified | 6263 |
| 110 | Ga0466718_006750 | 3300042617 | Bacteria | 7617 |
| 111 | Ga0466723_232665 | 3300042618 | Bacteria | 5615 |
| 112 | Ga0466726_054467 | 3300042619 | Bacteria | 8480 |
| 113 | Ga0466729_169731 | 3300042621 | Bacteria | 2381 |
| 114 | Ga0466720_148622 | 3300042607 | Bacteria | 6978 |
| 115 | Ga0466722_115309 | 3300042609 | Bacteria | 5098 |
| 116 | Ga0562378_1830 | 3300056814 | Bacteria | 20825 |
| 117 | Ga0562377_0803 | 3300056842 | Unclassified | 42585 |
| 118 | Ga0562375_5194 | 3300056856 | Unclassified | 8377 |
| 119 | Ga0562376_2160 | 3300056857 | Unclassified | 24664 |
| 120 | Ga0123356_10000449 | 3300010049 | Bacteria | 46460 |
| 121 | Ga0264413_123191 | 3300024493 | Bacteria | 4095 |
| 122 | Ga0466694_079165 | 3300042594 | Bacteria | 40053 |
| 123 | Ga0466699_022612 | 3300042597 | Bacteria | 3591 |
| 124 | Ga0466699_235710 | 3300042597 | Bacteria | 2493 |
| 125 | Ga0466699_300722 | 3300042597 | Bacteria | 14137 |
| 126 | JGI24695J34938_10000049 | 3300002450 | Bacteria | 91446 |
| 127 | JGI24695J34938_10000812 | 3300002450 | Bacteria | 29016 |
| 128 | JGI24695J34938_10002795 | 3300002450 | Bacteria | 12790 |
| 129 | Ga0072941_1000017 | 3300005201 | Bacteria | 22407 |
| 130 | Ga0072941_1035174 | 3300005201 | Unclassified | 4853 |
| 131 | Ga0072941_1096586 | 3300005201 | Bacteria | 9207 |
| 132 | Ga0466712_027724 | 3300042614 | Bacteria | 9162 |
| 133 | Ga0466718_052483 | 3300042617 | Bacteria | 8601 |
| 134 | Ga0466707_414532 | 3300042601 | Bacteria | 3349 |
| 135 | Ga0466721_242624 | 3300042608 | Bacteria | 64943 |
| 136 | Ga0466705_250183 | 3300042612 | Bacteria | 5928 |
| 137 | Ga0590811_01306 | 3300060704 | Unclassified | 2619 |
| 138 | Ga0123356_10000007 | 3300010049 | Bacteria | 240704 |
| 139 | Ga0123353_10007222 | 3300010167 | Bacteria | 14967 |
| 140 | Ga0264413_101300 | 3300024493 | Bacteria | 5601 |
| 141 | Ga0415639_012201 | 3300038395 | Bacteria | 7171 |
| 142 | Ga0415639_190035 | 3300038395 | Bacteria | 4657 |
| 143 | Ga0466690_425831 | 3300042590 | Bacteria | 5555 |
| 144 | Ga0466693_046844 | 3300042592 | Bacteria | 19759 |
| 145 | Ga0466691_127830 | 3300042593 | Bacteria | 3136 |
| 146 | Ga0466694_147121 | 3300042594 | Bacteria | 6988 |
| 147 | Ga0466703_420710 | 3300042636 | Bacteria | 6555 |
| 148 | Ga0466708_452532 | 3300042652 | Bacteria | 34741 |
| 149 | HBC_ctgsDRAFT_1000196 | 3300000333 | Bacteria | 14481 |
| 150 | JGI24698J34947_10005401 | 3300002449 | Bacteria | 7009 |
| 151 | JGI24698J34947_10022931 | 3300002449 | Unclassified | 3341 |
| 152 | JGI24698J34947_10026024 | 3300002449 | Unclassified | 3111 |
| 153 | JGI24698J34947_10029738 | 3300002449 | Bacteria | 2885 |
| 154 | JGI24698J34947_10029754 | 3300002449 | Bacteria | 2884 |
| 155 | JGI24695J34938_10000145 | 3300002450 | Bacteria | 64417 |
| 156 | JGI24695J34938_10003504 | 3300002450 | Bacteria | 10901 |
| 157 | JGI24695J34938_10004213 | 3300002450 | Bacteria | 9565 |
| 158 | JGI24695J34938_10008184 | 3300002450 | Bacteria | 6003 |
| 159 | Ga0072941_1026104 | 3300005201 | Bacteria | 28177 |
| 160 | Ga0072941_1086165 | 3300005201 | Bacteria | 5972 |
| 161 | Ga0466705_423432 | 3300042612 | Bacteria | 13039 |
| 162 | Ga0466712_148505 | 3300042614 | Bacteria | 41544 |
| 163 | Ga0466712_155558 | 3300042614 | Bacteria | 36572 |
| 164 | Ga0466712_170633 | 3300042614 | Bacteria | 27190 |
| 165 | Ga0466711_036387 | 3300042615 | Bacteria | 8468 |
| 166 | Ga0466718_017986 | 3300042617 | Unclassified | 14314 |
| 167 | Ga0466723_209252 | 3300042618 | Bacteria | 16096 |
| 168 | Ga0466716_083964 | 3300042605 | Bacteria | 10290 |
| 169 | Ga0466732_328822 | 3300042656 | Bacteria | 2793 |
| 170 | Ga0590808_02246 | 3300060701 | Unclassified | 1718 |
| 171 | Ga0590774_02400 | 3300060758 | Unclassified | 2104 |
| 172 | Ga0123356_10001164 | 3300010049 | Bacteria | 29125 |
| 173 | Ga0123356_10076459 | 3300010049 | Bacteria | 3155 |
| 174 | Ga0264413_100299 | 3300024493 | Bacteria | 10426 |
| 175 | Ga0264413_100302 | 3300024493 | Bacteria | 69754 |
| 176 | Ga0415639_011155 | 3300038395 | Bacteria | 8382 |
| 177 | Ga0466694_065842 | 3300042594 | Bacteria | 35703 |
| 178 | Ga0466694_335217 | 3300042594 | Bacteria | 5736 |
| 179 | Ga0466731_204697 | 3300042622 | Unclassified | 36475 |
| 180 | Ga0466702_182763 | 3300042635 | Bacteria | 6887 |
| 181 | Ga0466704_126424 | 3300042643 | Unclassified | 13812 |
| 182 | JGI24698J34947_10000789 | 3300002449 | Bacteria | 15767 |
| 183 | JGI24698J34947_10003716 | 3300002449 | Unclassified | 8298 |
| 184 | JGI24695J34938_10000443 | 3300002450 | Bacteria | 40027 |
| 185 | JGI24695J34938_10000452 | 3300002450 | Bacteria | 39831 |
| 186 | JGI24695J34938_10001107 | 3300002450 | Bacteria | 24311 |
| 187 | JGI24695J34938_10002974 | 3300002450 | Bacteria | 12214 |
| 188 | Ga0072940_1002763 | 3300005200 | Bacteria | 5841 |
| 189 | Ga0072941_1037068 | 3300005201 | Bacteria | 10275 |
| 190 | Ga0074263_100341 | 3300005485 | Bacteria | 6283 |
| 191 | Ga0466712_244485 | 3300042614 | Bacteria | 43012 |
| 192 | Ga0466711_331489 | 3300042615 | Bacteria | 14739 |
| 193 | Ga0466718_036855 | 3300042617 | Bacteria | 10997 |
| 194 | Ga0466718_168762 | 3300042617 | Unclassified | 5336 |
| 195 | Ga0466723_315428 | 3300042618 | Bacteria | 9743 |
| 196 | Ga0466728_231929 | 3300042620 | Bacteria | 4534 |
| 197 | Ga0466720_114190 | 3300042607 | Bacteria | 10410 |
| 198 | Ga0466698_347647 | 3300042610 | Bacteria | 8063 |
| 199 | Ga0562379_4161 | 3300056790 | Unclassified | 7933 |
| 200 | Ga0562378_1364 | 3300056814 | Unclassified | 27093 |
| 201 | Ga0562377_0638 | 3300056842 | Unclassified | 52479 |
| 202 | Ga0123353_10041358 | 3300010167 | Bacteria | 7280 |
| 203 | Ga0264413_101301 | 3300024493 | Bacteria | 53125 |
| 204 | Ga0264413_121310 | 3300024493 | Bacteria | 4206 |
| 205 | Ga0415639_077235 | 3300038395 | Bacteria | 8800 |
| 206 | Ga0466690_196722 | 3300042590 | Bacteria | 3843 |
| 207 | Ga0466693_149690 | 3300042592 | Bacteria | 25532 |
| 208 | Ga0466694_131062 | 3300042594 | Bacteria | 33615 |
| 209 | Ga0466699_144835 | 3300042597 | Bacteria | 41381 |
| 210 | Ga0466699_351689 | 3300042597 | Bacteria | 2724 |
| 211 | Ga0466703_407339 | 3300042636 | Bacteria | 2500 |
| 212 | AustNasuHG_c1000040 | 3300000089 | Bacteria | 32335 |
| 213 | AustNasuHG_c1008120 | 3300000089 | Bacteria | 3722 |
| 214 | JGI24698J34947_10008779 | 3300002449 | Bacteria | 5543 |
| 215 | JGI24695J34938_10000017 | 3300002450 | Bacteria | 115659 |
| 216 | JGI24695J34938_10000140 | 3300002450 | Bacteria | 65738 |
| 217 | JGI24695J34938_10000933 | 3300002450 | Bacteria | 26685 |
| 218 | JGI24695J34938_10001275 | 3300002450 | Bacteria | 22092 |
| 219 | JGI24695J34938_10017202 | 3300002450 | Bacteria | 3651 |
| 220 | Ga0072941_1014210 | 3300005201 | Bacteria | 33023 |
| 221 | Ga0072941_1037067 | 3300005201 | Bacteria | 5988 |
| 222 | Ga0466705_408484 | 3300042612 | Bacteria | 6846 |
| 223 | Ga0466712_117468 | 3300042614 | Bacteria | 53603 |
| 224 | Ga0466712_243529 | 3300042614 | Bacteria | 40070 |
| 225 | Ga0466718_064199 | 3300042617 | Bacteria | 8827 |
| 226 | Ga0466718_105346 | 3300042617 | Bacteria | 8415 |
| 227 | Ga0466722_097393 | 3300042609 | Bacteria | 5943 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF05524 | GO:0009401 | phosphoenolpyruvate-dependent sugar phosphotransferase system | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.