Protein Family IF00521

Metagenome Metatranscriptome Isolate
263 Members
89 Samples
227 Scaffolds
567.38 Avg Length

🧬 Representative Sequence

ID
3300002449|JGI24698J34947_10029738|JGI24698J34947_100297382
Length
590 aa
Sequence
MQRLSPDCASTVSDSFFFSGMKLNGKVAAPGAAVGRIYIYKKNFNLPVESFVGEGEEQSQLDRYFLVKKQAIDXLEKXXISVHKHDKKKADIFKAHQEIVDDIIINEEIPARILNERWAGDWAIYQVYETVILVLRQSADPRVSERAADFDDVRSLLLRLWYGSKSSNLTCPPQPAIIAAGDLLPTDTAGLDKENVLAILTEKGGITSHTAIIARSYGIPTVLGIEGLLAIVKHGQLAAVDADEGTVFIEPDEKIVSEYTERSAAFFRDRQEANAFLKSEGLTADGVKIDIGLNIGESEHELEAQQYADSAGLFRTEFLYMGRKTLPSEEEQFSVYRKTLAAFGKKPVILRTLDIGGDKKLSSIDLPKEENPFLGNRAIRLCFSRPDIFKTQIRAALRASVYGNLWLMLPMVGSLDDIRRAKELIAAAGAELKKEGRQFAEVKTGIMIEIPSIALIADLAAKEVDFASIGSNDLCQYLCAADRMNIGVEEYYQSCHPAMWRLINHVAASFTKAGKPLSVCGELGGDPLTVPVLIGLGLRKLSMGEASIAVVKRAIASLTVKACEEKAKKVLTLSTAAEVREYLSNNIIG*

πŸ“Š Sample Types

Isolate 13.7%
Metagenome 85.2%
MAG 0.0%
Metatranscriptome 1.1%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 34.5%
Termitidae 25.3%
Kalotermitidae 14.9%
Tenebrionidae 10.3%
Culicidae 4.6%
Rhinotermitidae 3.4%
Passalidae 1.1%
Apidae 1.1%
Vespidae 1.1%
Hormaphididae 1.1%
Termopsidae 1.1%
Chrysomelidae 1.1%

🌳 Taxonomy

Archaea 1
Bacteria 227
Eukaryota 0
Viruses 1
Unclassified 34

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 8118997823 Spiroplasma platyhelix PALS-1 Isolate Unclassified
2 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
3 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
4 2781125641 Treponema sp. Co191P1bin27 Isolate Unclassified
5 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
6 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
7 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
8 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
9 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
10 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
11 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
12 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
13 2554235383 Spiroplasma diminutum CUAS-1 Isolate Culicidae
14 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
15 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
16 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
17 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
18 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
19 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
20 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
21 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
22 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
23 2561511192 Spiroplasma taiwanense CT-1 Isolate Culicidae
24 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
25 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
26 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
27 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
28 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
29 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
30 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
31 2558860238 Spiroplasma sabaudiense Ar-1343 Isolate Culicidae
32 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
33 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
34 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
35 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
36 3300060758 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_PS_b (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
37 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
38 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
39 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
40 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
41 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
42 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
43 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
44 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
45 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
46 2791355053 Spiroplasma monobiae MQ-1 Isolate Vespidae
47 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
48 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
49 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
50 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
51 3300060701 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_PP_c (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
52 3300060704 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_PP_oats_c (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
53 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
54 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
55 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
56 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
57 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
58 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
59 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
60 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
61 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
62 3002300227 Buchnera aphidicola (Nipponaphis monzeni) Nmo Isolate Hormaphididae
63 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
64 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
65 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
66 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
67 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
68 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
69 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
70 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
71 2989426036 Spiroplasma platyhelix PALS-1 Isolate Unclassified
72 2558860239 Spiroplasma culicicola AES-1 Isolate Culicidae
73 2563366575 Spiroplasma apis B31 Isolate Unclassified
74 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
75 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
76 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
77 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
78 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
79 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
80 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
81 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
82 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
83 2998832060 Enterobacteriaceae endosymbiont of Donacia proxima DproxSym Isolate Chrysomelidae
84 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
85 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
86 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
87 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
88 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
89 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562378_0360 3300056814 Unclassified 88460
2 Ga0562378_0713 3300056814 Unclassified 47852
3 Ga0562375_2498 3300056856 Unclassified 20382
4 Ga0562376_1290 3300056857 Unclassified 36096
5 Ga0123356_10000340 3300010049 Bacteria 53881
6 Ga0123356_10001432 3300010049 Bacteria 26388
7 Ga0123356_10008149 3300010049 Unclassified 10431
8 Ga0123356_10014673 3300010049 Bacteria 7529
9 Ga0264413_101302 3300024493 Bacteria 8738
10 Ga0466731_134725 3300042622 Bacteria 3697
11 Ga0466702_020931 3300042635 Bacteria 8931
12 Ga0466702_123183 3300042635 Bacteria 9423
13 Ga0466703_273517 3300042636 Bacteria 4028
14 JGI24698J34947_10000431 3300002449 Bacteria 19275
15 JGI24698J34947_10012317 3300002449 Bacteria 4687
16 JGI24698J34947_10044686 3300002449 Bacteria 2265
17 JGI24695J34938_10000389 3300002450 Bacteria 43422
18 JGI24695J34938_10002524 3300002450 Bacteria 13864
19 Ga0072940_1021456 3300005200 Bacteria 20392
20 Ga0466712_148519 3300042614 Bacteria 7403
21 Ga0466712_176072 3300042614 Bacteria 26085
22 Ga0466711_278247 3300042615 Bacteria 26787
23 Ga0466715_390624 3300042616 Bacteria 11765
24 Ga0466718_018769 3300042617 Bacteria 8038
25 Ga0466718_065218 3300042617 Bacteria 4449
26 Ga0466718_068815 3300042617 Bacteria 2131
27 Ga0466718_097411 3300042617 Viruses 3699
28 Ga0466723_098488 3300042618 Bacteria 13331
29 Ga0466721_102511 3300042608 Bacteria 6212
30 Ga0562379_2159 3300056790 Unclassified 17635
31 Ga0562376_1505 3300056857 Unclassified 32261
32 Ga0562374_0368 3300057007 Unclassified 83380
33 Ga0123356_10000079 3300010049 Bacteria 103173
34 Ga0415639_024687 3300038395 Bacteria 6844
35 Ga0466693_121705 3300042592 Bacteria 24410
36 Ga0466694_051780 3300042594 Bacteria 5428
37 Ga0466694_236252 3300042594 Bacteria 11024
38 Ga0466694_331835 3300042594 Bacteria 2939
39 Ga0466702_110136 3300042635 Bacteria 6157
40 Ga0466708_069710 3300042652 Bacteria 10053
41 JGI24702J35022_10024377 3300002462 Bacteria 3270
42 Ga0068305_10082051 3300005083 Bacteria 8285
43 Ga0072941_1003814 3300005201 Bacteria 13358
44 Ga0072941_1065781 3300005201 Bacteria 6255
45 Ga0466712_019586 3300042614 Bacteria 4130
46 Ga0466712_039754 3300042614 Bacteria 6530
47 Ga0466712_210893 3300042614 Bacteria 3300
48 Ga0466712_299391 3300042614 Bacteria 27724
49 Ga0466711_052740 3300042615 Bacteria 2293
50 Ga0466718_069328 3300042617 Bacteria 45967
51 Ga0466718_111319 3300042617 Bacteria 2087
52 Ga0466718_146517 3300042617 Bacteria 2767
53 Ga0466718_168474 3300042617 Bacteria 5238
54 Ga0466728_132013 3300042620 Bacteria 3096
55 Ga0466716_058240 3300042605 Bacteria 8732
56 Ga0466720_026908 3300042607 Bacteria 32753
57 Ga0466720_044902 3300042607 Bacteria 6320
58 Ga0466720_073592 3300042607 Bacteria 36208
59 Ga0466732_099703 3300042656 Bacteria 3755
60 Ga0466732_299089 3300042656 Bacteria 51902
61 Ga0562379_3510 3300056790 Unclassified 10111
62 Ga0562378_3609 3300056814 Unclassified 8728
63 Ga0562376_0009 3300056857 Bacteria 1013235
64 Ga0562376_3691 3300056857 Unclassified 14780
65 Ga0123355_10008558 3300009826 Bacteria 15458
66 Ga0123356_10000512 3300010049 Bacteria 43209
67 Ga0123356_10006211 3300010049 Bacteria 12081
68 Ga0123356_10031859 3300010049 Bacteria 4933
69 Ga0415639_029150 3300038395 Bacteria 2557
70 Ga0466692_071937 3300042591 Bacteria 4920
71 Ga0466694_365203 3300042594 Bacteria 39783
72 Ga0466695_315985 3300042595 Bacteria 38906
73 Ga0466696_013557 3300042596 Bacteria 3563
74 Ga0466703_040354 3300042636 Bacteria 25570
75 2227666268 2225789004 Bacteria 10397
76 JGI24698J34947_10000304 3300002449 Bacteria 21529
77 JGI24698J34947_10007323 3300002449 Bacteria 6064
78 JGI24698J34947_10011624 3300002449 Bacteria 4832
79 JGI24698J34947_10047320 3300002449 Bacteria 2183
80 JGI24695J34938_10000129 3300002450 Bacteria 68011
81 JGI24695J34938_10000749 3300002450 Bacteria 30507
82 JGI24695J34938_10003835 3300002450 Archaea 10207
83 Ga0072940_1011136 3300005200 Bacteria 6250
84 Ga0072941_1002871 3300005201 Bacteria 36049
85 Ga0466712_056807 3300042614 Bacteria 31023
86 Ga0466715_572420 3300042616 Bacteria 103400
87 Ga0466718_041952 3300042617 Unclassified 2061
88 Ga0466728_316738 3300042620 Bacteria 11290
89 Ga0466719_295056 3300042606 Bacteria 6755
90 Ga0466719_548595 3300042606 Bacteria 5618
91 Ga0466720_078091 3300042607 Bacteria 5708
92 Ga0562379_3891 3300056790 Unclassified 8774
93 Ga0562378_2290 3300056814 Unclassified 16545
94 Ga0562375_0997 3300056856 Unclassified 45016
95 Ga0466702_086874 3300042635 Bacteria 5054
96 Ga0466702_287467 3300042635 Bacteria 10468
97 Ga0466703_033500 3300042636 Bacteria 10197
98 Ga0466708_404354 3300042652 Bacteria 7632
99 JGI24698J34947_10003971 3300002449 Bacteria 8046
100 JGI24698J34947_10023399 3300002449 Unclassified 3306
101 JGI24698J34947_10028382 3300002449 Bacteria 2963
102 JGI24695J34938_10000063 3300002450 Bacteria 87942
103 JGI24695J34938_10000132 3300002450 Bacteria 67814
104 JGI24695J34938_10002694 3300002450 Bacteria 13199
105 JGI24695J34938_10006030 3300002450 Bacteria 7395
106 JGI24695J34938_10021258 3300002450 Bacteria 3177
107 Ga0466712_008276 3300042614 Bacteria 3014
108 Ga0466712_014889 3300042614 Bacteria 58641
109 Ga0466712_124392 3300042614 Unclassified 6263
110 Ga0466718_006750 3300042617 Bacteria 7617
111 Ga0466723_232665 3300042618 Bacteria 5615
112 Ga0466726_054467 3300042619 Bacteria 8480
113 Ga0466729_169731 3300042621 Bacteria 2381
114 Ga0466720_148622 3300042607 Bacteria 6978
115 Ga0466722_115309 3300042609 Bacteria 5098
116 Ga0562378_1830 3300056814 Bacteria 20825
117 Ga0562377_0803 3300056842 Unclassified 42585
118 Ga0562375_5194 3300056856 Unclassified 8377
119 Ga0562376_2160 3300056857 Unclassified 24664
120 Ga0123356_10000449 3300010049 Bacteria 46460
121 Ga0264413_123191 3300024493 Bacteria 4095
122 Ga0466694_079165 3300042594 Bacteria 40053
123 Ga0466699_022612 3300042597 Bacteria 3591
124 Ga0466699_235710 3300042597 Bacteria 2493
125 Ga0466699_300722 3300042597 Bacteria 14137
126 JGI24695J34938_10000049 3300002450 Bacteria 91446
127 JGI24695J34938_10000812 3300002450 Bacteria 29016
128 JGI24695J34938_10002795 3300002450 Bacteria 12790
129 Ga0072941_1000017 3300005201 Bacteria 22407
130 Ga0072941_1035174 3300005201 Unclassified 4853
131 Ga0072941_1096586 3300005201 Bacteria 9207
132 Ga0466712_027724 3300042614 Bacteria 9162
133 Ga0466718_052483 3300042617 Bacteria 8601
134 Ga0466707_414532 3300042601 Bacteria 3349
135 Ga0466721_242624 3300042608 Bacteria 64943
136 Ga0466705_250183 3300042612 Bacteria 5928
137 Ga0590811_01306 3300060704 Unclassified 2619
138 Ga0123356_10000007 3300010049 Bacteria 240704
139 Ga0123353_10007222 3300010167 Bacteria 14967
140 Ga0264413_101300 3300024493 Bacteria 5601
141 Ga0415639_012201 3300038395 Bacteria 7171
142 Ga0415639_190035 3300038395 Bacteria 4657
143 Ga0466690_425831 3300042590 Bacteria 5555
144 Ga0466693_046844 3300042592 Bacteria 19759
145 Ga0466691_127830 3300042593 Bacteria 3136
146 Ga0466694_147121 3300042594 Bacteria 6988
147 Ga0466703_420710 3300042636 Bacteria 6555
148 Ga0466708_452532 3300042652 Bacteria 34741
149 HBC_ctgsDRAFT_1000196 3300000333 Bacteria 14481
150 JGI24698J34947_10005401 3300002449 Bacteria 7009
151 JGI24698J34947_10022931 3300002449 Unclassified 3341
152 JGI24698J34947_10026024 3300002449 Unclassified 3111
153 JGI24698J34947_10029738 3300002449 Bacteria 2885
154 JGI24698J34947_10029754 3300002449 Bacteria 2884
155 JGI24695J34938_10000145 3300002450 Bacteria 64417
156 JGI24695J34938_10003504 3300002450 Bacteria 10901
157 JGI24695J34938_10004213 3300002450 Bacteria 9565
158 JGI24695J34938_10008184 3300002450 Bacteria 6003
159 Ga0072941_1026104 3300005201 Bacteria 28177
160 Ga0072941_1086165 3300005201 Bacteria 5972
161 Ga0466705_423432 3300042612 Bacteria 13039
162 Ga0466712_148505 3300042614 Bacteria 41544
163 Ga0466712_155558 3300042614 Bacteria 36572
164 Ga0466712_170633 3300042614 Bacteria 27190
165 Ga0466711_036387 3300042615 Bacteria 8468
166 Ga0466718_017986 3300042617 Unclassified 14314
167 Ga0466723_209252 3300042618 Bacteria 16096
168 Ga0466716_083964 3300042605 Bacteria 10290
169 Ga0466732_328822 3300042656 Bacteria 2793
170 Ga0590808_02246 3300060701 Unclassified 1718
171 Ga0590774_02400 3300060758 Unclassified 2104
172 Ga0123356_10001164 3300010049 Bacteria 29125
173 Ga0123356_10076459 3300010049 Bacteria 3155
174 Ga0264413_100299 3300024493 Bacteria 10426
175 Ga0264413_100302 3300024493 Bacteria 69754
176 Ga0415639_011155 3300038395 Bacteria 8382
177 Ga0466694_065842 3300042594 Bacteria 35703
178 Ga0466694_335217 3300042594 Bacteria 5736
179 Ga0466731_204697 3300042622 Unclassified 36475
180 Ga0466702_182763 3300042635 Bacteria 6887
181 Ga0466704_126424 3300042643 Unclassified 13812
182 JGI24698J34947_10000789 3300002449 Bacteria 15767
183 JGI24698J34947_10003716 3300002449 Unclassified 8298
184 JGI24695J34938_10000443 3300002450 Bacteria 40027
185 JGI24695J34938_10000452 3300002450 Bacteria 39831
186 JGI24695J34938_10001107 3300002450 Bacteria 24311
187 JGI24695J34938_10002974 3300002450 Bacteria 12214
188 Ga0072940_1002763 3300005200 Bacteria 5841
189 Ga0072941_1037068 3300005201 Bacteria 10275
190 Ga0074263_100341 3300005485 Bacteria 6283
191 Ga0466712_244485 3300042614 Bacteria 43012
192 Ga0466711_331489 3300042615 Bacteria 14739
193 Ga0466718_036855 3300042617 Bacteria 10997
194 Ga0466718_168762 3300042617 Unclassified 5336
195 Ga0466723_315428 3300042618 Bacteria 9743
196 Ga0466728_231929 3300042620 Bacteria 4534
197 Ga0466720_114190 3300042607 Bacteria 10410
198 Ga0466698_347647 3300042610 Bacteria 8063
199 Ga0562379_4161 3300056790 Unclassified 7933
200 Ga0562378_1364 3300056814 Unclassified 27093
201 Ga0562377_0638 3300056842 Unclassified 52479
202 Ga0123353_10041358 3300010167 Bacteria 7280
203 Ga0264413_101301 3300024493 Bacteria 53125
204 Ga0264413_121310 3300024493 Bacteria 4206
205 Ga0415639_077235 3300038395 Bacteria 8800
206 Ga0466690_196722 3300042590 Bacteria 3843
207 Ga0466693_149690 3300042592 Bacteria 25532
208 Ga0466694_131062 3300042594 Bacteria 33615
209 Ga0466699_144835 3300042597 Bacteria 41381
210 Ga0466699_351689 3300042597 Bacteria 2724
211 Ga0466703_407339 3300042636 Bacteria 2500
212 AustNasuHG_c1000040 3300000089 Bacteria 32335
213 AustNasuHG_c1008120 3300000089 Bacteria 3722
214 JGI24698J34947_10008779 3300002449 Bacteria 5543
215 JGI24695J34938_10000017 3300002450 Bacteria 115659
216 JGI24695J34938_10000140 3300002450 Bacteria 65738
217 JGI24695J34938_10000933 3300002450 Bacteria 26685
218 JGI24695J34938_10001275 3300002450 Bacteria 22092
219 JGI24695J34938_10017202 3300002450 Bacteria 3651
220 Ga0072941_1014210 3300005201 Bacteria 33023
221 Ga0072941_1037067 3300005201 Bacteria 5988
222 Ga0466705_408484 3300042612 Bacteria 6846
223 Ga0466712_117468 3300042614 Bacteria 53603
224 Ga0466712_243529 3300042614 Bacteria 40070
225 Ga0466718_064199 3300042617 Bacteria 8827
226 Ga0466718_105346 3300042617 Bacteria 8415
227 Ga0466722_097393 3300042609 Bacteria 5943

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00391 PEP-utilizers PEP-utilising enzyme, mobile domain 173 245 0.96
PF02896 PEP-utilizers_C PEP-utilising enzyme, PEP-binding domain 273 558 0.96
PF05524 PEP-utilisers_N PEP-utilising enzyme, N-terminal 25 146 0.92

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF05524 GO:0009401 phosphoenolpyruvate-dependent sugar phosphotransferase system BP

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.