Protein Family IF00510

Metagenome Isolate
212 Members
58 Samples
194 Scaffolds
337.35 Avg Length

🧬 Representative Sequence

ID
3300002449|JGI24698J34947_10018330|JGI24698J34947_100183308
Length
380 aa
Sequence
MRLTIIAGFGKGKNTHSVGPRHTRPATLAESLASYYNSIMELKEALEKSAGLIDTCRKELAKRIVGQQGMIDGLLSALVAGGHVLLEGVPGLAKTLAVKSLAEITGLGFKRIQFTPDLLPADLTGTLIWEQNTGSFSVRKGPVFANVILADEINRAPAKVQSALLEAMEEKQVTIGETSYPLPEPFFVLATENPIEHEGTYSLPEAELDRFLMKLLVSYPQGEEELEIVSRAATLGINNEKAAPLSPVLDMGGLALLRNAANEIHVDRKIAEYMVSVAGATRPAATRSAQVQAGKAQSAENGLYRYIAFGASVRASIALHRCSRIRALFEGRNFVSPEDVKAAAVPVLRHRIVLSYEAEAEGLNADAVISRILSHVPVP*

📊 Sample Types

Isolate 8.5%
Metagenome 91.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 37.5%
Unclassified 28.6%
Kalotermitidae 19.6%
Rhinotermitidae 5.4%
Blattidae 3.6%
Hodotermitidae 1.8%
Blaberidae 1.8%
Termopsidae 1.8%

🌳 Taxonomy

Archaea 0
Bacteria 200
Eukaryota 0
Viruses 0
Unclassified 12

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
2 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
3 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
4 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
5 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
6 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
7 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
8 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
9 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
10 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
11 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
12 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
13 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
14 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
15 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
16 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
17 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
18 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
19 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
20 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
21 2772190975 Treponema sp. RmG30 Isolate Blaberidae
22 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
23 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
24 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
25 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
26 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
27 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
28 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
29 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
30 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
31 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
32 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
33 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
34 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
35 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
36 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
37 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
38 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
39 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
40 3004672520 Bacteroides sp. 51 Isolate Blattidae
41 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
42 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
43 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
44 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
45 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
46 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
47 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
48 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
49 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
50 2922326829 Bacteroides sp. 224 Isolate Blattidae
51 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
52 2781125682 Treponema sp. Lab288P1bin107 Isolate Unclassified
53 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
54 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
55 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
56 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
57 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
58 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466707_143476 3300042601 Bacteria 1547
2 Ga0466716_279465 3300042605 Bacteria 2571
3 Ga0466716_377874 3300042605 Bacteria 2400
4 Ga0466720_156585 3300042607 Bacteria 11128
5 Ga0466715_245136 3300042616 Bacteria 17418
6 Ga0466718_008382 3300042617 Bacteria 16557
7 Ga0466718_026466 3300042617 Bacteria 14634
8 Ga0466718_044933 3300042617 Bacteria 7415
9 Ga0466718_135821 3300042617 Bacteria 16584
10 Ga0466723_329571 3300042618 Bacteria 10644
11 Ga0466726_115380 3300042619 Bacteria 17582
12 Ga0466704_160025 3300042643 Bacteria 25768
13 Ga0466709_024688 3300042648 Bacteria 14410
14 Ga0466709_158341 3300042648 Bacteria 8383
15 AustNasuHG_c1007098 3300000089 Bacteria 3990
16 AustNasuHG_c1010484 3300000089 Bacteria 3228
17 JGI24698J34947_10005262 3300002449 Bacteria 7100
18 JGI24698J34947_10006765 3300002449 Bacteria 6298
19 JGI24695J34938_10000089 3300002450 Bacteria 79818
20 JGI24695J34938_10002414 3300002450 Bacteria 14332
21 Ga0415639_028922 3300038395 Bacteria 9376
22 Ga0466691_156154 3300042593 Bacteria 10092
23 Ga0466694_376369 3300042594 Bacteria 1417
24 Ga0466699_070122 3300042597 Bacteria 27696
25 Ga0466699_146550 3300042597 Bacteria 1488
26 Ga0466699_214027 3300042597 Bacteria 3169
27 Ga0123356_10016738 3300010049 Bacteria 6991
28 Ga0466732_199449 3300042656 Bacteria 11696
29 Ga0466707_370049 3300042601 Unclassified 2044
30 Ga0466720_125260 3300042607 Bacteria 23757
31 Ga0466721_224612 3300042608 Bacteria 2983
32 Ga0466712_071595 3300042614 Bacteria 4551
33 Ga0466718_071475 3300042617 Bacteria 23698
34 Ga0466728_021453 3300042620 Bacteria 3416
35 AustNasuHG_c1025995 3300000089 Bacteria 1831
36 JGI24698J34947_10009276 3300002449 Bacteria 5399
37 JGI24698J34947_10018330 3300002449 Bacteria 3784
38 JGI24695J34938_10000069 3300002450 Bacteria 86031
39 JGI24695J34938_10000591 3300002450 Bacteria 34913
40 Ga0072940_1011363 3300005200 Bacteria 12425
41 Ga0466694_109696 3300042594 Bacteria 19514
42 Ga0466694_319436 3300042594 Bacteria 51857
43 Ga0466699_109704 3300042597 Bacteria 13024
44 Ga0466699_314762 3300042597 Bacteria 14020
45 Ga0123356_10014180 3300010049 Bacteria 7665
46 Ga0123356_10057318 3300010049 Bacteria 3631
47 Ga0123356_10188099 3300010049 Bacteria 2093
48 Ga0466720_080391 3300042607 Bacteria 6465
49 Ga0466720_107549 3300042607 Bacteria 11185
50 Ga0466720_126501 3300042607 Bacteria 11592
51 Ga0466720_191921 3300042607 Bacteria 9389
52 Ga0466712_014114 3300042614 Bacteria 11681
53 Ga0466729_036324 3300042621 Bacteria 2720
54 Ga0466708_165141 3300042652 Bacteria 38683
55 AustNasuHG_c1011089 3300000089 Bacteria 3127
56 JGI24698J34947_10000148 3300002449 Bacteria 26603
57 JGI24698J34947_10001234 3300002449 Bacteria 13371
58 JGI24698J34947_10002561 3300002449 Bacteria 9811
59 JGI24698J34947_10051809 3300002449 Bacteria 2062
60 JGI24695J34938_10000338 3300002450 Bacteria 46275
61 JGI24695J34938_10001859 3300002450 Bacteria 17150
62 JGI24695J34938_10008543 3300002450 Bacteria 5827
63 JGI24695J34938_10021117 3300002450 Bacteria 3191
64 JGI24695J34938_10067192 3300002450 Bacteria 1509
65 Ga0072941_1122573 3300005201 Bacteria 1195
66 Ga0264413_101362 3300024493 Bacteria 11023
67 Ga0415639_038200 3300038395 Bacteria 24274
68 Ga0466690_202746 3300042590 Bacteria 2178
69 Ga0466690_208441 3300042590 Bacteria 17129
70 Ga0466690_215602 3300042590 Bacteria 1771
71 Ga0466691_169655 3300042593 Bacteria 12023
72 Ga0466694_011754 3300042594 Bacteria 23880
73 Ga0466699_008368 3300042597 Bacteria 35242
74 Ga0123356_10000341 3300010049 Bacteria 53848
75 Ga0123356_10001159 3300010049 Bacteria 29161
76 Ga0123356_10110721 3300010049 Bacteria 2652
77 Ga0123353_10014494 3300010167 Bacteria 11371
78 Ga0123353_10043612 3300010167 Bacteria 7107
79 Ga0123354_10082700 3300010882 Bacteria 4523
80 Ga0466732_011260 3300042656 Bacteria 3804
81 Ga0466732_054799 3300042656 Bacteria 38151
82 Ga0466707_044645 3300042601 Unclassified 3305
83 Ga0466720_077151 3300042607 Bacteria 2868
84 Ga0466720_178468 3300042607 Bacteria 9406
85 Ga0466722_024187 3300042609 Bacteria 3100
86 Ga0466697_014368 3300042611 Bacteria 2473
87 Ga0466702_277172 3300042635 Bacteria 12732
88 Ga0466709_126320 3300042648 Bacteria 20237
89 Ga0466708_196775 3300042652 Bacteria 7020
90 AustNasuHG_c1012616 3300000089 Bacteria 2917
91 JGI24695J34938_10001830 3300002450 Bacteria 17379
92 Ga0072940_1069648 3300005200 Unclassified 2101
93 Ga0072941_1048670 3300005201 Bacteria 14124
94 Ga0264413_100942 3300024493 Bacteria 33361
95 Ga0264413_104615 3300024493 Bacteria 27626
96 Ga0264413_116312 3300024493 Bacteria 5021
97 Ga0415639_076218 3300038395 Bacteria 3716
98 Ga0415639_225113 3300038395 Bacteria 1790
99 Ga0466694_274367 3300042594 Bacteria 2942
100 Ga0123356_10000381 3300010049 Bacteria 50607
101 Ga0123356_10016878 3300010049 Bacteria 6958
102 Ga0466706_049948 3300042599 Bacteria 2854
103 Ga0466720_172209 3300042607 Bacteria 13999
104 Ga0466712_087255 3300042614 Bacteria 14310
105 Ga0466718_005838 3300042617 Unclassified 10039
106 Ga0466718_012939 3300042617 Bacteria 16746
107 Ga0466723_032224 3300042618 Bacteria 8269
108 Ga0466723_044181 3300042618 Bacteria 301962
109 JGI24698J34947_10003170 3300002449 Bacteria 8906
110 JGI24698J34947_10005668 3300002449 Bacteria 6846
111 JGI24698J34947_10015737 3300002449 Unclassified 4113
112 JGI24695J34938_10003306 3300002450 Bacteria 11362
113 Ga0072941_1001161 3300005201 Bacteria 23690
114 Ga0072941_1098090 3300005201 Bacteria 13069
115 Ga0123356_10001277 3300010049 Bacteria 27854
116 Ga0123353_10065465 3300010167 Bacteria 5835
117 Ga0466732_109268 3300042656 Bacteria 1600
118 Ga0466717_193518 3300042604 Bacteria 1045
119 Ga0466715_112906 3300042616 Bacteria 10555
120 Ga0466718_030173 3300042617 Bacteria 12295
121 Ga0466718_056839 3300042617 Bacteria 2815
122 Ga0466718_058741 3300042617 Bacteria 19720
123 Ga0466718_085672 3300042617 Bacteria 17769
124 Ga0466718_113787 3300042617 Bacteria 1484
125 AustNasuHG_c1001556 3300000089 Bacteria 8266
126 AustNasuHG_c1005619 3300000089 Unclassified 4487
127 AustNasuHG_c1010932 3300000089 Bacteria 3151
128 JGI24695J34938_10002448 3300002450 Bacteria 14189
129 JGI24695J34938_10004158 3300002450 Bacteria 9632
130 Ga0072941_1079060 3300005201 Bacteria 3616
131 Ga0466690_120969 3300042590 Bacteria 15744
132 Ga0466692_058549 3300042591 Bacteria 23920
133 Ga0466693_028114 3300042592 Bacteria 110002
134 Ga0466696_126161 3300042596 Bacteria 18379
135 Ga0466696_241663 3300042596 Bacteria 9300
136 Ga0466699_003514 3300042597 Bacteria 2570
137 Ga0466699_013728 3300042597 Unclassified 1475
138 Ga0466699_186045 3300042597 Unclassified 4086
139 Ga0466699_240172 3300042597 Bacteria 12820
140 Ga0466699_245704 3300042597 Unclassified 1226
141 Ga0466699_373111 3300042597 Bacteria 1465
142 Ga0466707_039825 3300042601 Unclassified 2065
143 Ga0466716_116385 3300042605 Bacteria 8701
144 Ga0466716_317648 3300042605 Bacteria 3144
145 Ga0466720_060462 3300042607 Bacteria 2496
146 Ga0466720_085782 3300042607 Bacteria 23553
147 Ga0466698_238008 3300042610 Bacteria 24051
148 Ga0466712_163556 3300042614 Bacteria 10392
149 Ga0466712_212313 3300042614 Bacteria 17680
150 Ga0466718_004171 3300042617 Bacteria 6345
151 Ga0466718_137729 3300042617 Bacteria 6555
152 Ga0466702_005054 3300042635 Bacteria 2589
153 Ga0466704_548901 3300042643 Bacteria 14375
154 AustNasuHG_c1003380 3300000089 Bacteria 5763
155 JGI24698J34947_10000078 3300002449 Bacteria 31619
156 JGI24698J34947_10000405 3300002449 Bacteria 19640
157 JGI24695J34938_10000320 3300002450 Bacteria 47216
158 JGI24695J34938_10012441 3300002450 Bacteria 4509
159 JGI24695J34938_10056855 3300002450 Bacteria 1684
160 Ga0072940_1023030 3300005200 Bacteria 3812
161 Ga0072941_1088516 3300005201 Bacteria 10677
162 Ga0264413_100539 3300024493 Bacteria 37798
163 Ga0466692_051902 3300042591 Bacteria 4947
164 Ga0466694_000747 3300042594 Bacteria 6043
165 Ga0466694_152393 3300042594 Bacteria 16469
166 Ga0466699_113829 3300042597 Bacteria 12833
167 Ga0466699_168373 3300042597 Bacteria 1308
168 Ga0466699_308758 3300042597 Bacteria 16034
169 Ga0123353_10216281 3300010167 Bacteria 3001
170 Ga0466732_256852 3300042656 Bacteria 7545
171 Ga0466721_246589 3300042608 Unclassified 3023
172 Ga0466712_002651 3300042614 Bacteria 15034
173 Ga0466712_056491 3300042614 Bacteria 16484
174 Ga0466712_127108 3300042614 Bacteria 13157
175 Ga0466712_130926 3300042614 Bacteria 31676
176 Ga0466712_222511 3300042614 Unclassified 1841
177 Ga0466711_092244 3300042615 Bacteria 2875
178 Ga0466711_135218 3300042615 Bacteria 25428
179 Ga0466715_054751 3300042616 Bacteria 7312
180 Ga0466715_329291 3300042616 Bacteria 15546
181 Ga0466718_050289 3300042617 Bacteria 32903
182 Ga0466718_065905 3300042617 Bacteria 7549
183 Ga0466718_094903 3300042617 Bacteria 22521
184 Ga0466729_135873 3300042621 Bacteria 1865
185 AustNasuHG_c1011866 3300000089 Bacteria 3015
186 JGI24698J34947_10001660 3300002449 Bacteria 11862
187 JGI24698J34947_10009414 3300002449 Bacteria 5366
188 JGI24695J34938_10003311 3300002450 Bacteria 11353
189 Ga0074263_115129 3300005485 Bacteria 2747
190 Ga0466690_005798 3300042590 Bacteria 8538
191 Ga0466694_003292 3300042594 Bacteria 1621
192 Ga0466699_057689 3300042597 Bacteria 1228
193 Ga0123356_10116031 3300010049 Bacteria 2595
194 Ga0123356_10670590 3300010049 Bacteria 1205

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF07726 AAA_3 ATPase family associated with various cellular activities (AAA) 83 213 1
PF17863 AAA_lid_2 AAA lid domain 306 372 0.97
PF07728 AAA_5 AAA domain (dynein-related subfamily) 83 211 0.89
PF20030 bpMoxR MoxR domain in the MoxR-vWA-beta-propeller ternary systems 56 227 0.82
PF00493 MCM MCM P-loop domain 80 196 0.82

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.