Protein Family IF00509
Metagenome
Isolate
167
Members
51
Samples
151
Scaffolds
331.25
Avg Length
Representative Sequence
- ID
- 3300002449|JGI24698J34947_10017730|JGI24698J34947_100177303
- Length
- 354 aa
- Sequence
- MNTGFCIITNVTCNLAHSLFLSYHKQIMDTNVKQSIELLINNIRGLISVDIKKLEYIIAAQIAGGHVILADSHGVGKTSLARALAQSIRWRPEDMAAAGSASSGEVKMEGFSRVQCTVDLLPQDILGYNRFIGHSGELFFNKGPVFAHFVLCDEINLLTPKTQGSFFQVMEEQSVTIEGKLYRLTDPFFIIATMNLKGVHLFPLPVPQLDRFMIRLSLGYPSEENEIEIVNRHGRIDAWDNFQSVIDSADLIRWKKMVDEVQMHPDVTSYIVNCVRQTIETPASPRAGVRISRLARSLALCRGMDYVPVDIVKEIFIHAMAHRIITRDPSIPPQAPLQSILNTVPVEPKREKS*
Sample Types
Isolate
9.6%
Metagenome
90.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
56.2%
Unclassified
33.3%
Kalotermitidae
4.2%
Rhinotermitidae
4.2%
Termopsidae
2.1%
Taxonomy
Archaea
0
Bacteria
137
Eukaryota
0
Viruses
0
Unclassified
30
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 2 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 3 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 4 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 5 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 6 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 7 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 8 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 9 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 10 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 11 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 12 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 13 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 14 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 15 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 16 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 17 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 18 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 19 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 20 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 21 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 22 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 23 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 24 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 25 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 26 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 27 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 28 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 29 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 30 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 31 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 32 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 33 | 2228664001 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4a from Florida USA | Metagenome | Termitidae |
| 34 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 35 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 36 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 37 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 38 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 39 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 40 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 41 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 42 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 43 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 44 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 45 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 46 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 47 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 48 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 49 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 50 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 51 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466700_020935 | 3300042600 | Bacteria | 3327 |
| 2 | Ga0466721_191339 | 3300042608 | Bacteria | 79638 |
| 3 | Ga0466718_031843 | 3300042617 | Bacteria | 5423 |
| 4 | Ga0123356_10000339 | 3300010049 | Bacteria | 53899 |
| 5 | Ga0123353_10371439 | 3300010167 | Bacteria | 2144 |
| 6 | Ga0466731_161490 | 3300042622 | Bacteria | 2477 |
| 7 | Ga0466702_136537 | 3300042635 | Unclassified | 5601 |
| 8 | Ga0466702_405942 | 3300042635 | Bacteria | 1444 |
| 9 | JGI24698J34947_10011357 | 3300002449 | Unclassified | 4891 |
| 10 | JGI24698J34947_10055722 | 3300002449 | Unclassified | 1968 |
| 11 | JGI24695J34938_10001848 | 3300002450 | Bacteria | 17184 |
| 12 | Ga0074263_109807 | 3300005485 | Bacteria | 1297 |
| 13 | Ga0466694_004101 | 3300042594 | Bacteria | 10723 |
| 14 | Ga0466732_040381 | 3300042656 | Bacteria | 8222 |
| 15 | Ga0466712_072051 | 3300042614 | Bacteria | 23884 |
| 16 | Ga0466718_051320 | 3300042617 | Unclassified | 5454 |
| 17 | Ga0466718_076169 | 3300042617 | Bacteria | 4199 |
| 18 | Ga0123356_10000289 | 3300010049 | Bacteria | 57741 |
| 19 | Ga0123356_10000624 | 3300010049 | Bacteria | 39100 |
| 20 | Ga0123356_10005625 | 3300010049 | Bacteria | 12738 |
| 21 | Ga0123356_10538717 | 3300010049 | Bacteria | 1327 |
| 22 | Ga0123356_10897607 | 3300010049 | Unclassified | 1057 |
| 23 | AustNasuHG_c1011427 | 3300000089 | Bacteria | 3078 |
| 24 | JGI24698J34947_10001021 | 3300002449 | Bacteria | 14397 |
| 25 | JGI24695J34938_10001885 | 3300002450 | Bacteria | 16986 |
| 26 | JGI24695J34938_10002116 | 3300002450 | Bacteria | 15540 |
| 27 | JGI24695J34938_10007356 | 3300002450 | Bacteria | 6458 |
| 28 | JGI24702J35022_10011569 | 3300002462 | Bacteria | 4917 |
| 29 | Ga0415639_094356 | 3300038395 | Bacteria | 6887 |
| 30 | Ga0466694_195350 | 3300042594 | Unclassified | 8220 |
| 31 | Ga0466699_072735 | 3300042597 | Bacteria | 11283 |
| 32 | Ga0466720_037282 | 3300042607 | Bacteria | 17761 |
| 33 | Ga0466722_150186 | 3300042609 | Bacteria | 36176 |
| 34 | Ga0466698_003252 | 3300042610 | Bacteria | 17096 |
| 35 | Ga0466712_052094 | 3300042614 | Bacteria | 19638 |
| 36 | Ga0466712_055000 | 3300042614 | Bacteria | 14859 |
| 37 | Ga0466712_131951 | 3300042614 | Bacteria | 8458 |
| 38 | Ga0466718_039271 | 3300042617 | Bacteria | 10529 |
| 39 | Ga0123355_10468891 | 3300009826 | Bacteria | 1575 |
| 40 | Ga0123356_10004266 | 3300010049 | Unclassified | 14789 |
| 41 | Ga0123356_10255451 | 3300010049 | Unclassified | 1833 |
| 42 | Ga0123356_10397702 | 3300010049 | Unclassified | 1515 |
| 43 | Ga0466702_098488 | 3300042635 | Bacteria | 11614 |
| 44 | JGI24698J34947_10017729 | 3300002449 | Bacteria | 3856 |
| 45 | JGI24698J34947_10065510 | 3300002449 | Unclassified | 1771 |
| 46 | JGI24695J34938_10003592 | 3300002450 | Bacteria | 10670 |
| 47 | JGI24695J34938_10006167 | 3300002450 | Bacteria | 7290 |
| 48 | JGI24695J34938_10007407 | 3300002450 | Bacteria | 6427 |
| 49 | Ga0072940_1076615 | 3300005200 | Bacteria | 2949 |
| 50 | Ga0415639_127341 | 3300038395 | Unclassified | 4368 |
| 51 | Ga0466694_005840 | 3300042594 | Bacteria | 106514 |
| 52 | Ga0466699_247692 | 3300042597 | Bacteria | 15823 |
| 53 | Ga0466720_013877 | 3300042607 | Bacteria | 25198 |
| 54 | Ga0466712_031932 | 3300042614 | Bacteria | 31317 |
| 55 | Ga0466712_047061 | 3300042614 | Bacteria | 14486 |
| 56 | Ga0466712_086999 | 3300042614 | Bacteria | 4684 |
| 57 | Ga0466712_219278 | 3300042614 | Bacteria | 5323 |
| 58 | Ga0123356_10000222 | 3300010049 | Bacteria | 65834 |
| 59 | Ga0123356_10006751 | 3300010049 | Bacteria | 11550 |
| 60 | Ga0123353_10168853 | 3300010167 | Bacteria | 3475 |
| 61 | Ga0466731_306250 | 3300042622 | Bacteria | 1987 |
| 62 | Ga0466702_082999 | 3300042635 | Bacteria | 2308 |
| 63 | FAAS_10001401 | 3300001880 | Bacteria | 1306 |
| 64 | JGI24698J34947_10017730 | 3300002449 | Bacteria | 3855 |
| 65 | JGI24695J34938_10000801 | 3300002450 | Bacteria | 29191 |
| 66 | JGI24695J34938_10001213 | 3300002450 | Bacteria | 22849 |
| 67 | JGI24695J34938_10011461 | 3300002450 | Unclassified | 4774 |
| 68 | Ga0072941_1139138 | 3300005201 | Unclassified | 1780 |
| 69 | Ga0466694_115623 | 3300042594 | Bacteria | 2583 |
| 70 | Ga0466721_294697 | 3300042608 | Bacteria | 1911 |
| 71 | Ga0466712_028564 | 3300042614 | Bacteria | 16187 |
| 72 | Ga0123356_10000281 | 3300010049 | Bacteria | 58777 |
| 73 | Ga0123356_10009287 | 3300010049 | Bacteria | 9713 |
| 74 | Ga0466731_057013 | 3300042622 | Bacteria | 49553 |
| 75 | JGI24698J34947_10001224 | 3300002449 | Bacteria | 13430 |
| 76 | JGI24698J34947_10002570 | 3300002449 | Bacteria | 9797 |
| 77 | JGI24698J34947_10055656 | 3300002449 | Unclassified | 1970 |
| 78 | JGI24698J34947_10061454 | 3300002449 | Unclassified | 1849 |
| 79 | JGI24695J34938_10000377 | 3300002450 | Bacteria | 44279 |
| 80 | JGI24695J34938_10006484 | 3300002450 | Bacteria | 7009 |
| 81 | Ga0072940_1012279 | 3300005200 | Bacteria | 17174 |
| 82 | Ga0074263_103572 | 3300005485 | Unclassified | 3591 |
| 83 | Ga0415639_059979 | 3300038395 | Bacteria | 5078 |
| 84 | Ga0466693_290277 | 3300042592 | Bacteria | 1556 |
| 85 | Ga0466693_306794 | 3300042592 | Unclassified | 2187 |
| 86 | Ga0466694_105747 | 3300042594 | Bacteria | 4182 |
| 87 | Ga0466699_303677 | 3300042597 | Bacteria | 13712 |
| 88 | Ga0466701_001048 | 3300042598 | Unclassified | 1885 |
| 89 | Ga0466700_475493 | 3300042600 | Bacteria | 1772 |
| 90 | Ga0466720_107868 | 3300042607 | Unclassified | 6205 |
| 91 | Ga0466712_104891 | 3300042614 | Bacteria | 15435 |
| 92 | Ga0466718_042249 | 3300042617 | Bacteria | 8907 |
| 93 | Ga0466718_046071 | 3300042617 | Unclassified | 7083 |
| 94 | Ga0123356_10000361 | 3300010049 | Bacteria | 51710 |
| 95 | Ga0123356_10066848 | 3300010049 | Unclassified | 3366 |
| 96 | Ga0123356_10289871 | 3300010049 | Bacteria | 1737 |
| 97 | Ga0123353_10015077 | 3300010167 | Bacteria | 11197 |
| 98 | Ga0466731_236729 | 3300042622 | Bacteria | 1369 |
| 99 | Ga0466727_241656 | 3300042655 | Bacteria | 2492 |
| 100 | AustNasuHG_c1001974 | 3300000089 | Bacteria | 7375 |
| 101 | JGI24698J34947_10006758 | 3300002449 | Bacteria | 6300 |
| 102 | JGI24695J34938_10000205 | 3300002450 | Bacteria | 55959 |
| 103 | JGI24702J35022_10016985 | 3300002462 | Bacteria | 3983 |
| 104 | Ga0072940_1004285 | 3300005200 | Unclassified | 5379 |
| 105 | Ga0072941_1017792 | 3300005201 | Unclassified | 1501 |
| 106 | Ga0466693_182929 | 3300042592 | Bacteria | 17973 |
| 107 | Ga0466693_360354 | 3300042592 | Bacteria | 40039 |
| 108 | Ga0466712_017821 | 3300042614 | Unclassified | 4541 |
| 109 | Ga0466712_073349 | 3300042614 | Bacteria | 17371 |
| 110 | Ga0466712_203876 | 3300042614 | Unclassified | 3519 |
| 111 | Ga0466712_289776 | 3300042614 | Bacteria | 27357 |
| 112 | Ga0466715_355653 | 3300042616 | Bacteria | 15531 |
| 113 | Ga0123356_10003241 | 3300010049 | Bacteria | 17096 |
| 114 | Ga0123356_10037463 | 3300010049 | Bacteria | 4525 |
| 115 | Ga0123356_10055820 | 3300010049 | Bacteria | 3679 |
| 116 | Ga0123356_10262843 | 3300010049 | Bacteria | 1811 |
| 117 | Ga0466731_060696 | 3300042622 | Bacteria | 3689 |
| 118 | Ga0466702_260922 | 3300042635 | Bacteria | 2537 |
| 119 | Ga0466702_300841 | 3300042635 | Bacteria | 7628 |
| 120 | 2230929964 | 2228664001 | Bacteria | 7449 |
| 121 | JGI24695J34938_10000064 | 3300002450 | Bacteria | 87537 |
| 122 | JGI24695J34938_10000411 | 3300002450 | Bacteria | 41645 |
| 123 | JGI24695J34938_10001445 | 3300002450 | Bacteria | 20122 |
| 124 | JGI24695J34938_10002725 | 3300002450 | Bacteria | 13029 |
| 125 | JGI24695J34938_10007051 | 3300002450 | Bacteria | 6648 |
| 126 | JGI24695J34938_10016033 | 3300002450 | Unclassified | 3825 |
| 127 | JGI24697J35500_11264001 | 3300002507 | Bacteria | 3262 |
| 128 | Ga0466693_354156 | 3300042592 | Bacteria | 1376 |
| 129 | Ga0466693_417842 | 3300042592 | Unclassified | 1306 |
| 130 | Ga0466694_006403 | 3300042594 | Bacteria | 53277 |
| 131 | Ga0466699_100706 | 3300042597 | Bacteria | 1116 |
| 132 | Ga0466705_280154 | 3300042612 | Bacteria | 6180 |
| 133 | Ga0466717_151697 | 3300042604 | Unclassified | 2988 |
| 134 | Ga0466720_098710 | 3300042607 | Bacteria | 26481 |
| 135 | Ga0466720_236380 | 3300042607 | Bacteria | 17616 |
| 136 | Ga0466712_062469 | 3300042614 | Bacteria | 11887 |
| 137 | Ga0466718_002323 | 3300042617 | Bacteria | 11037 |
| 138 | Ga0466718_074514 | 3300042617 | Bacteria | 8206 |
| 139 | Ga0123356_10017853 | 3300010049 | Bacteria | 6740 |
| 140 | AustNasuHG_c1000630 | 3300000089 | Unclassified | 12482 |
| 141 | AustNasuHG_c1030674 | 3300000089 | Bacteria | 1541 |
| 142 | JGI24695J34938_10000172 | 3300002450 | Bacteria | 60289 |
| 143 | JGI24695J34938_10000316 | 3300002450 | Bacteria | 47576 |
| 144 | JGI24695J34938_10001139 | 3300002450 | Bacteria | 23767 |
| 145 | JGI24695J34938_10002659 | 3300002450 | Bacteria | 13329 |
| 146 | JGI24695J34938_10005684 | 3300002450 | Bacteria | 7699 |
| 147 | JGI24696J40584_12924699 | 3300002834 | Bacteria | 1391 |
| 148 | Ga0074263_108883 | 3300005485 | Unclassified | 2697 |
| 149 | Ga0264413_101220 | 3300024493 | Bacteria | 47245 |
| 150 | Ga0415639_038892 | 3300038395 | Bacteria | 3701 |
| 151 | Ga0466692_100840 | 3300042591 | Bacteria | 27256 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.