Protein Family IF00509

Metagenome Isolate
167 Members
51 Samples
151 Scaffolds
331.25 Avg Length

🧬 Representative Sequence

ID
3300002449|JGI24698J34947_10017730|JGI24698J34947_100177303
Length
354 aa
Sequence
MNTGFCIITNVTCNLAHSLFLSYHKQIMDTNVKQSIELLINNIRGLISVDIKKLEYIIAAQIAGGHVILADSHGVGKTSLARALAQSIRWRPEDMAAAGSASSGEVKMEGFSRVQCTVDLLPQDILGYNRFIGHSGELFFNKGPVFAHFVLCDEINLLTPKTQGSFFQVMEEQSVTIEGKLYRLTDPFFIIATMNLKGVHLFPLPVPQLDRFMIRLSLGYPSEENEIEIVNRHGRIDAWDNFQSVIDSADLIRWKKMVDEVQMHPDVTSYIVNCVRQTIETPASPRAGVRISRLARSLALCRGMDYVPVDIVKEIFIHAMAHRIITRDPSIPPQAPLQSILNTVPVEPKREKS*

πŸ“Š Sample Types

Isolate 9.6%
Metagenome 90.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 56.2%
Unclassified 33.3%
Kalotermitidae 4.2%
Rhinotermitidae 4.2%
Termopsidae 2.1%

🌳 Taxonomy

Archaea 0
Bacteria 137
Eukaryota 0
Viruses 0
Unclassified 30

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
2 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
3 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
4 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
5 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
6 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
7 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
8 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
9 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
10 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
11 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
12 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
13 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
14 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
15 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
16 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
17 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
18 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
19 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
20 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
21 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
22 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
23 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
24 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
25 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
26 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
27 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
28 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
29 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
30 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
31 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
32 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
33 2228664001 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4a from Florida USA Metagenome Termitidae
34 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
35 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
36 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
37 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
38 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
39 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
40 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
41 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
42 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
43 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
44 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
45 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
46 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
47 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
48 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
49 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
50 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
51 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466700_020935 3300042600 Bacteria 3327
2 Ga0466721_191339 3300042608 Bacteria 79638
3 Ga0466718_031843 3300042617 Bacteria 5423
4 Ga0123356_10000339 3300010049 Bacteria 53899
5 Ga0123353_10371439 3300010167 Bacteria 2144
6 Ga0466731_161490 3300042622 Bacteria 2477
7 Ga0466702_136537 3300042635 Unclassified 5601
8 Ga0466702_405942 3300042635 Bacteria 1444
9 JGI24698J34947_10011357 3300002449 Unclassified 4891
10 JGI24698J34947_10055722 3300002449 Unclassified 1968
11 JGI24695J34938_10001848 3300002450 Bacteria 17184
12 Ga0074263_109807 3300005485 Bacteria 1297
13 Ga0466694_004101 3300042594 Bacteria 10723
14 Ga0466732_040381 3300042656 Bacteria 8222
15 Ga0466712_072051 3300042614 Bacteria 23884
16 Ga0466718_051320 3300042617 Unclassified 5454
17 Ga0466718_076169 3300042617 Bacteria 4199
18 Ga0123356_10000289 3300010049 Bacteria 57741
19 Ga0123356_10000624 3300010049 Bacteria 39100
20 Ga0123356_10005625 3300010049 Bacteria 12738
21 Ga0123356_10538717 3300010049 Bacteria 1327
22 Ga0123356_10897607 3300010049 Unclassified 1057
23 AustNasuHG_c1011427 3300000089 Bacteria 3078
24 JGI24698J34947_10001021 3300002449 Bacteria 14397
25 JGI24695J34938_10001885 3300002450 Bacteria 16986
26 JGI24695J34938_10002116 3300002450 Bacteria 15540
27 JGI24695J34938_10007356 3300002450 Bacteria 6458
28 JGI24702J35022_10011569 3300002462 Bacteria 4917
29 Ga0415639_094356 3300038395 Bacteria 6887
30 Ga0466694_195350 3300042594 Unclassified 8220
31 Ga0466699_072735 3300042597 Bacteria 11283
32 Ga0466720_037282 3300042607 Bacteria 17761
33 Ga0466722_150186 3300042609 Bacteria 36176
34 Ga0466698_003252 3300042610 Bacteria 17096
35 Ga0466712_052094 3300042614 Bacteria 19638
36 Ga0466712_055000 3300042614 Bacteria 14859
37 Ga0466712_131951 3300042614 Bacteria 8458
38 Ga0466718_039271 3300042617 Bacteria 10529
39 Ga0123355_10468891 3300009826 Bacteria 1575
40 Ga0123356_10004266 3300010049 Unclassified 14789
41 Ga0123356_10255451 3300010049 Unclassified 1833
42 Ga0123356_10397702 3300010049 Unclassified 1515
43 Ga0466702_098488 3300042635 Bacteria 11614
44 JGI24698J34947_10017729 3300002449 Bacteria 3856
45 JGI24698J34947_10065510 3300002449 Unclassified 1771
46 JGI24695J34938_10003592 3300002450 Bacteria 10670
47 JGI24695J34938_10006167 3300002450 Bacteria 7290
48 JGI24695J34938_10007407 3300002450 Bacteria 6427
49 Ga0072940_1076615 3300005200 Bacteria 2949
50 Ga0415639_127341 3300038395 Unclassified 4368
51 Ga0466694_005840 3300042594 Bacteria 106514
52 Ga0466699_247692 3300042597 Bacteria 15823
53 Ga0466720_013877 3300042607 Bacteria 25198
54 Ga0466712_031932 3300042614 Bacteria 31317
55 Ga0466712_047061 3300042614 Bacteria 14486
56 Ga0466712_086999 3300042614 Bacteria 4684
57 Ga0466712_219278 3300042614 Bacteria 5323
58 Ga0123356_10000222 3300010049 Bacteria 65834
59 Ga0123356_10006751 3300010049 Bacteria 11550
60 Ga0123353_10168853 3300010167 Bacteria 3475
61 Ga0466731_306250 3300042622 Bacteria 1987
62 Ga0466702_082999 3300042635 Bacteria 2308
63 FAAS_10001401 3300001880 Bacteria 1306
64 JGI24698J34947_10017730 3300002449 Bacteria 3855
65 JGI24695J34938_10000801 3300002450 Bacteria 29191
66 JGI24695J34938_10001213 3300002450 Bacteria 22849
67 JGI24695J34938_10011461 3300002450 Unclassified 4774
68 Ga0072941_1139138 3300005201 Unclassified 1780
69 Ga0466694_115623 3300042594 Bacteria 2583
70 Ga0466721_294697 3300042608 Bacteria 1911
71 Ga0466712_028564 3300042614 Bacteria 16187
72 Ga0123356_10000281 3300010049 Bacteria 58777
73 Ga0123356_10009287 3300010049 Bacteria 9713
74 Ga0466731_057013 3300042622 Bacteria 49553
75 JGI24698J34947_10001224 3300002449 Bacteria 13430
76 JGI24698J34947_10002570 3300002449 Bacteria 9797
77 JGI24698J34947_10055656 3300002449 Unclassified 1970
78 JGI24698J34947_10061454 3300002449 Unclassified 1849
79 JGI24695J34938_10000377 3300002450 Bacteria 44279
80 JGI24695J34938_10006484 3300002450 Bacteria 7009
81 Ga0072940_1012279 3300005200 Bacteria 17174
82 Ga0074263_103572 3300005485 Unclassified 3591
83 Ga0415639_059979 3300038395 Bacteria 5078
84 Ga0466693_290277 3300042592 Bacteria 1556
85 Ga0466693_306794 3300042592 Unclassified 2187
86 Ga0466694_105747 3300042594 Bacteria 4182
87 Ga0466699_303677 3300042597 Bacteria 13712
88 Ga0466701_001048 3300042598 Unclassified 1885
89 Ga0466700_475493 3300042600 Bacteria 1772
90 Ga0466720_107868 3300042607 Unclassified 6205
91 Ga0466712_104891 3300042614 Bacteria 15435
92 Ga0466718_042249 3300042617 Bacteria 8907
93 Ga0466718_046071 3300042617 Unclassified 7083
94 Ga0123356_10000361 3300010049 Bacteria 51710
95 Ga0123356_10066848 3300010049 Unclassified 3366
96 Ga0123356_10289871 3300010049 Bacteria 1737
97 Ga0123353_10015077 3300010167 Bacteria 11197
98 Ga0466731_236729 3300042622 Bacteria 1369
99 Ga0466727_241656 3300042655 Bacteria 2492
100 AustNasuHG_c1001974 3300000089 Bacteria 7375
101 JGI24698J34947_10006758 3300002449 Bacteria 6300
102 JGI24695J34938_10000205 3300002450 Bacteria 55959
103 JGI24702J35022_10016985 3300002462 Bacteria 3983
104 Ga0072940_1004285 3300005200 Unclassified 5379
105 Ga0072941_1017792 3300005201 Unclassified 1501
106 Ga0466693_182929 3300042592 Bacteria 17973
107 Ga0466693_360354 3300042592 Bacteria 40039
108 Ga0466712_017821 3300042614 Unclassified 4541
109 Ga0466712_073349 3300042614 Bacteria 17371
110 Ga0466712_203876 3300042614 Unclassified 3519
111 Ga0466712_289776 3300042614 Bacteria 27357
112 Ga0466715_355653 3300042616 Bacteria 15531
113 Ga0123356_10003241 3300010049 Bacteria 17096
114 Ga0123356_10037463 3300010049 Bacteria 4525
115 Ga0123356_10055820 3300010049 Bacteria 3679
116 Ga0123356_10262843 3300010049 Bacteria 1811
117 Ga0466731_060696 3300042622 Bacteria 3689
118 Ga0466702_260922 3300042635 Bacteria 2537
119 Ga0466702_300841 3300042635 Bacteria 7628
120 2230929964 2228664001 Bacteria 7449
121 JGI24695J34938_10000064 3300002450 Bacteria 87537
122 JGI24695J34938_10000411 3300002450 Bacteria 41645
123 JGI24695J34938_10001445 3300002450 Bacteria 20122
124 JGI24695J34938_10002725 3300002450 Bacteria 13029
125 JGI24695J34938_10007051 3300002450 Bacteria 6648
126 JGI24695J34938_10016033 3300002450 Unclassified 3825
127 JGI24697J35500_11264001 3300002507 Bacteria 3262
128 Ga0466693_354156 3300042592 Bacteria 1376
129 Ga0466693_417842 3300042592 Unclassified 1306
130 Ga0466694_006403 3300042594 Bacteria 53277
131 Ga0466699_100706 3300042597 Bacteria 1116
132 Ga0466705_280154 3300042612 Bacteria 6180
133 Ga0466717_151697 3300042604 Unclassified 2988
134 Ga0466720_098710 3300042607 Bacteria 26481
135 Ga0466720_236380 3300042607 Bacteria 17616
136 Ga0466712_062469 3300042614 Bacteria 11887
137 Ga0466718_002323 3300042617 Bacteria 11037
138 Ga0466718_074514 3300042617 Bacteria 8206
139 Ga0123356_10017853 3300010049 Bacteria 6740
140 AustNasuHG_c1000630 3300000089 Unclassified 12482
141 AustNasuHG_c1030674 3300000089 Bacteria 1541
142 JGI24695J34938_10000172 3300002450 Bacteria 60289
143 JGI24695J34938_10000316 3300002450 Bacteria 47576
144 JGI24695J34938_10001139 3300002450 Bacteria 23767
145 JGI24695J34938_10002659 3300002450 Bacteria 13329
146 JGI24695J34938_10005684 3300002450 Bacteria 7699
147 JGI24696J40584_12924699 3300002834 Bacteria 1391
148 Ga0074263_108883 3300005485 Unclassified 2697
149 Ga0264413_101220 3300024493 Bacteria 47245
150 Ga0415639_038892 3300038395 Bacteria 3701
151 Ga0466692_100840 3300042591 Bacteria 27256

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF07726 AAA_3 ATPase family associated with various cellular activities (AAA) 110 214 0.94
PF17863 AAA_lid_2 AAA lid domain 275 336 0.88

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.