Protein Family IF00506

Metagenome Isolate
222 Members
73 Samples
195 Scaffolds
320.99 Avg Length

🧬 Representative Sequence

ID
3300002449|JGI24698J34947_10012673|JGI24698J34947_100126735
Length
389 aa
Sequence
LIFCPQGHLYYITIFDFFTKLFWEISVSLKTRVNILVRIRLFCYSESMQARYLVPNDYMADPAVHVFNGRVFIYPSHDWDSGTGENDSGDHFDMKDYHVFSLDDVEKGAVTDHGVVLDVKDIPWAGRQLWDSDAACKNGKYYLYFPLKDKNDIFRIGAAVADRPEGPFVPQADPIRGSYSIDPCVFEENGEYFMYFGGLWGGQLQRYRDNKSLEGASFKADIPGCPRQPFGFPGDFFFPADSEPAIPPRVAKLSADMLQFAEEPRPVLIVDRDGKPLTQGDTQRRFFEASWMHKYNGKYYFSYSTGDTHLLCYATGGSPYGPFTYQGVILTPVTGWTTHHAIAEYRGKWYLFYHDSVPSGGRTYLRSLKVTELKYNADGSIQTLDGSL*

📊 Sample Types

Isolate 12.2%
Metagenome 87.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 32.4%
Unclassified 28.2%
Kalotermitidae 16.9%
Blattidae 11.3%
Rhinotermitidae 5.6%
Termopsidae 2.8%
Hodotermitidae 1.4%
Passalidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 203
Eukaryota 0
Viruses 0
Unclassified 19

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
2 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
3 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
4 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
5 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
6 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
7 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
8 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
9 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
10 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
11 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
12 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
13 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
14 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
15 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
16 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
17 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
18 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
19 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
20 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
21 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
22 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
23 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
24 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
25 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
26 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
27 3004672520 Bacteroides sp. 51 Isolate Blattidae
28 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
29 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
30 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
31 2781125633 Treponema sp. Co191P1bin38 Isolate Unclassified
32 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
33 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
34 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
35 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
36 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
37 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
38 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
39 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
40 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
41 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
42 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
43 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
44 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
45 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
46 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
47 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
48 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
49 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
50 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
51 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
52 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
53 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
54 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
55 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
56 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
57 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
58 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
59 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
60 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
61 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
62 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
63 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
64 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
65 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
66 3004667792 Bacteroides sp. 519 Isolate Blattidae
67 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
68 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
69 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
70 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
71 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
72 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
73 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466712_001544 3300042614 Bacteria 23939
2 Ga0466712_065452 3300042614 Bacteria 5785
3 Ga0466712_084065 3300042614 Bacteria 5129
4 Ga0466712_121056 3300042614 Unclassified 5282
5 Ga0466715_245705 3300042616 Bacteria 35968
6 Ga0466718_003837 3300042617 Bacteria 1959
7 Ga0466728_210988 3300042620 Bacteria 48284
8 Ga0415639_014909 3300038395 Bacteria 3724
9 Ga0415639_016117 3300038395 Bacteria 9784
10 Ga0466694_053233 3300042594 Bacteria 9798
11 Ga0466707_386979 3300042601 Bacteria 9148
12 Ga0466720_220981 3300042607 Unclassified 7949
13 Ga0466722_251493 3300042609 Bacteria 54791
14 Ga0466704_103112 3300042643 Bacteria 29222
15 Ga0466708_438512 3300042652 Bacteria 69541
16 Ga0466727_228665 3300042655 Bacteria 8496
17 AustNasuHG_c1007560 3300000089 Bacteria 3858
18 JGI24698J34947_10012421 3300002449 Bacteria 4667
19 JGI24698J34947_10017989 3300002449 Bacteria 3825
20 JGI24698J34947_10049741 3300002449 Bacteria 2116
21 JGI24698J34947_10072993 3300002449 Bacteria 1640
22 JGI24695J34938_10000549 3300002450 Bacteria 36271
23 JGI24695J34938_10001505 3300002450 Bacteria 19660
24 JGI24695J34938_10006190 3300002450 Bacteria 7272
25 JGI24702J35022_10071144 3300002462 Bacteria 1873
26 Ga0123356_10013834 3300010049 Bacteria 7771
27 Ga0466712_137740 3300042614 Bacteria 7990
28 Ga0466712_140739 3300042614 Bacteria 4767
29 Ga0466712_181503 3300042614 Bacteria 1411
30 Ga0466712_230496 3300042614 Unclassified 8178
31 Ga0466718_047903 3300042617 Unclassified 1439
32 Ga0415639_004164 3300038395 Bacteria 6514
33 Ga0466691_093192 3300042593 Bacteria 7346
34 Ga0466699_016782 3300042597 Bacteria 2057
35 Ga0466706_162648 3300042599 Bacteria 1025
36 Ga0466707_300389 3300042601 Bacteria 8688
37 Ga0466720_001295 3300042607 Bacteria 32202
38 Ga0466720_044219 3300042607 Bacteria 18655
39 Ga0466720_196993 3300042607 Bacteria 9576
40 AustNasuHG_c1011688 3300000089 Bacteria 3041
41 JGI24695J34938_10000622 3300002450 Bacteria 33781
42 JGI24695J34938_10001316 3300002450 Bacteria 21604
43 JGI24695J34938_10006500 3300002450 Bacteria 6997
44 JGI24695J34938_10007723 3300002450 Bacteria 6235
45 JGI24695J34938_10014206 3300002450 Bacteria 4140
46 JGI24695J34938_10018740 3300002450 Unclassified 3449
47 JGI24695J34938_10021281 3300002450 Bacteria 3174
48 Ga0123356_10000007 3300010049 Bacteria 240704
49 Ga0123356_10000123 3300010049 Bacteria 85175
50 Ga0123356_10021334 3300010049 Unclassified 6113
51 Ga0466710_262023 3300042613 Bacteria 2440
52 Ga0466712_113673 3300042614 Bacteria 4095
53 Ga0466718_071537 3300042617 Bacteria 5955
54 Ga0466728_484487 3300042620 Bacteria 15569
55 Ga0466729_032916 3300042621 Bacteria 2014
56 Ga0415639_070888 3300038395 Bacteria 3245
57 Ga0466692_181963 3300042591 Bacteria 4350
58 Ga0466694_156532 3300042594 Bacteria 4543
59 Ga0466699_383235 3300042597 Bacteria 1771
60 Ga0466720_174121 3300042607 Bacteria 15670
61 Ga0466722_103865 3300042609 Bacteria 5468
62 Ga0466731_092618 3300042622 Bacteria 2422
63 Ga0466703_044946 3300042636 Bacteria 9154
64 Ga0466704_216241 3300042643 Bacteria 8554
65 JGI24698J34947_10019112 3300002449 Bacteria 3700
66 JGI24695J34938_10023151 3300002450 Bacteria 2999
67 Ga0072941_1005562 3300005201 Bacteria 28183
68 Ga0072941_1045637 3300005201 Bacteria 5413
69 Ga0123355_10249907 3300009826 Bacteria 2498
70 Ga0123356_10022618 3300010049 Bacteria 5932
71 Ga0466733_077751 3300042659 Bacteria 11807
72 Ga0466712_035935 3300042614 Unclassified 2718
73 Ga0466712_195036 3300042614 Bacteria 17188
74 Ga0466718_129066 3300042617 Bacteria 12013
75 Ga0466694_071384 3300042594 Bacteria 50432
76 Ga0466699_144835 3300042597 Bacteria 41381
77 Ga0466707_151703 3300042601 Bacteria 2108
78 Ga0466716_276310 3300042605 Bacteria 5187
79 Ga0466703_211480 3300042636 Bacteria 1632
80 Ga0466709_061637 3300042648 Bacteria 61213
81 Ga0466709_174824 3300042648 Bacteria 24111
82 JGI24698J34947_10060748 3300002449 Bacteria 1863
83 JGI24695J34938_10002108 3300002450 Bacteria 15579
84 JGI24695J34938_10005849 3300002450 Bacteria 7565
85 Ga0072941_1000755 3300005201 Bacteria 6813
86 Ga0072941_1015435 3300005201 Bacteria 6889
87 Ga0072941_1017575 3300005201 Bacteria 12242
88 Ga0123356_10001935 3300010049 Bacteria 22414
89 Ga0123356_10027036 3300010049 Bacteria 5379
90 Ga0123356_10087331 3300010049 Bacteria 2962
91 Ga0466697_161350 3300042611 Bacteria 1108
92 Ga0466705_221502 3300042612 Bacteria 2634
93 Ga0466718_059495 3300042617 Bacteria 13391
94 Ga0466693_147270 3300042592 Bacteria 11696
95 Ga0466691_107157 3300042593 Bacteria 22324
96 Ga0466694_082419 3300042594 Bacteria 24426
97 Ga0466696_347954 3300042596 Bacteria 1599
98 Ga0466699_082945 3300042597 Bacteria 1222
99 Ga0466706_039675 3300042599 Bacteria 8021
100 Ga0466706_059353 3300042599 Unclassified 2954
101 Ga0466719_098046 3300042606 Bacteria 5993
102 Ga0466720_009046 3300042607 Bacteria 19213
103 Ga0466720_060432 3300042607 Bacteria 5368
104 Ga0466720_177916 3300042607 Bacteria 7310
105 Ga0466722_018356 3300042609 Bacteria 2306
106 Ga0466734_021026 3300042623 Bacteria 2123
107 JGI24698J34947_10005719 3300002449 Bacteria 6820
108 JGI24698J34947_10069819 3300002449 Bacteria 1694
109 JGI24695J34938_10000780 3300002450 Bacteria 29857
110 JGI24695J34938_10000868 3300002450 Bacteria 27957
111 JGI24695J34938_10011572 3300002450 Bacteria 4744
112 JGI24695J34938_10016312 3300002450 Bacteria 3781
113 Ga0072941_1017803 3300005201 Bacteria 8777
114 Ga0123356_10318399 3300010049 Bacteria 1668
115 Ga0466733_075896 3300042659 Bacteria 1239
116 Ga0466712_087123 3300042614 Bacteria 3897
117 Ga0466712_091100 3300042614 Unclassified 5844
118 Ga0466712_236472 3300042614 Unclassified 4181
119 Ga0466715_245759 3300042616 Bacteria 4832
120 Ga0466715_583205 3300042616 Bacteria 24186
121 Ga0466718_022235 3300042617 Bacteria 2467
122 Ga0264413_101087 3300024493 Bacteria 17433
123 Ga0415639_050869 3300038395 Bacteria 4406
124 Ga0466690_106099 3300042590 Bacteria 2194
125 Ga0466692_065090 3300042591 Bacteria 3725
126 Ga0466693_353865 3300042592 Unclassified 1618
127 Ga0466694_007514 3300042594 Bacteria 48427
128 Ga0466699_070932 3300042597 Bacteria 1732
129 Ga0466699_306510 3300042597 Bacteria 4527
130 Ga0466701_085995 3300042598 Bacteria 1902
131 Ga0466720_145268 3300042607 Bacteria 7852
132 JGI24698J34947_10023454 3300002449 Bacteria 3303
133 JGI24698J34947_10034656 3300002449 Bacteria 2639
134 JGI24695J34938_10001865 3300002450 Bacteria 17136
135 JGI24695J34938_10006468 3300002450 Bacteria 7028
136 JGI24695J34938_10017445 3300002450 Bacteria 3616
137 JGI24702J35022_10084526 3300002462 Bacteria 1722
138 JGI24699J35502_11130664 3300002509 Bacteria 5227
139 Ga0072941_1000365 3300005201 Bacteria 34340
140 Ga0072941_1006329 3300005201 Bacteria 19120
141 Ga0072941_1008716 3300005201 Bacteria 12752
142 Ga0072941_1028594 3300005201 Bacteria 2828
143 Ga0123356_10128863 3300010049 Bacteria 2475
144 Ga0123353_10261358 3300010167 Unclassified 2673
145 Ga0466715_061831 3300042616 Bacteria 11213
146 Ga0466718_083922 3300042617 Unclassified 1043
147 Ga0466726_112278 3300042619 Bacteria 7050
148 Ga0466729_052806 3300042621 Bacteria 3479
149 Ga0264413_101090 3300024493 Bacteria 21368
150 Ga0264413_107933 3300024493 Bacteria 7247
151 Ga0264413_118205 3300024493 Unclassified 3888
152 Ga0264413_121306 3300024493 Bacteria 1676
153 Ga0415639_076985 3300038395 Bacteria 3434
154 Ga0466694_005622 3300042594 Bacteria 25120
155 Ga0466694_320778 3300042594 Bacteria 1358
156 Ga0466713_141088 3300042602 Bacteria 20493
157 Ga0466720_048260 3300042607 Bacteria 6414
158 2227538514 2225789004 Bacteria 15924
159 JGI24698J34947_10012409 3300002449 Bacteria 4669
160 JGI24698J34947_10042972 3300002449 Unclassified 2319
161 JGI24698J34947_10062861 3300002449 Bacteria 1822
162 JGI24695J34938_10002780 3300002450 Bacteria 12824
163 JGI24695J34938_10005531 3300002450 Bacteria 7846
164 JGI24695J34938_10006227 3300002450 Unclassified 7240
165 JGI24695J34938_10013769 3300002450 Unclassified 4232
166 JGI24695J34938_10053634 3300002450 Bacteria 1753
167 JGI24699J35502_11134220 3300002509 Bacteria 66991
168 Ga0072941_1067597 3300005201 Bacteria 3750
169 Ga0123356_10133322 3300010049 Bacteria 2438
170 Ga0466705_266347 3300042612 Bacteria 15156
171 Ga0466712_018534 3300042614 Bacteria 2024
172 Ga0466712_073702 3300042614 Bacteria 60864
173 Ga0466712_087749 3300042614 Bacteria 43183
174 Ga0466712_168061 3300042614 Unclassified 2569
175 Ga0466715_140882 3300042616 Bacteria 2960
176 Ga0466693_228588 3300042592 Unclassified 3849
177 Ga0466693_420416 3300042592 Bacteria 28518
178 Ga0466695_318085 3300042595 Bacteria 14282
179 Ga0466729_224696 3300042621 Bacteria 4364
180 Ga0466731_012364 3300042622 Bacteria 28543
181 AustNasuHG_c1000384 3300000089 Bacteria 15338
182 JGI24698J34947_10012673 3300002449 Bacteria 4617
183 JGI24698J34947_10014286 3300002449 Bacteria 4324
184 JGI24695J34938_10000294 3300002450 Bacteria 49200
185 JGI24695J34938_10001709 3300002450 Bacteria 18148
186 JGI24695J34938_10005628 3300002450 Bacteria 7755
187 JGI24695J34938_10041266 3300002450 Bacteria 2072
188 JGI24695J34938_10069333 3300002450 Bacteria 1478
189 Ga0072940_1004679 3300005200 Bacteria 17094
190 Ga0072941_1019252 3300005201 Bacteria 1629
191 Ga0072941_1042864 3300005201 Bacteria 7867
192 Ga0072941_1044383 3300005201 Bacteria 4061
193 Ga0123356_10062409 3300010049 Bacteria 3481
194 Ga0123356_10088503 3300010049 Bacteria 2944
195 Ga0123356_10178295 3300010049 Bacteria 2144

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43 118 203 0.84

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.