Protein Family IF00502
Metagenome
Metatranscriptome
Isolate
200
Members
49
Samples
194
Scaffolds
182.19
Avg Length
Representative Sequence
- ID
- 3300002449|JGI24698J34947_10011152|JGI24698J34947_100111523
- Length
- 204 aa
- Sequence
- MTRKALNRLCLFSRRLIMAKVDGADTSFYMNPAAYAQVKPDRAGDKKNKGIRRGEKTAFSRFFDDLRGMTADELGPLRDLPASEDSVNFLMDDVRSAGDVLHSRPFPEEIIRYKQAVRNFINYVVKNAYTLEHEKGIPKFLKPGFTGQRGTDEAMSQKRYTKISVIDKKLEDLAAMLLSNQARQLELTSRLEEIRGLLIDLLQ*
Sample Types
Isolate
3.0%
Metagenome
96.5%
MAG
0.0%
Metatranscriptome
0.5%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
48.9%
Kalotermitidae
27.7%
Unclassified
12.8%
Rhinotermitidae
6.4%
Termopsidae
4.3%
Taxonomy
Archaea
0
Bacteria
196
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 2 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 5 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 6 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 7 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 8 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 9 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 10 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 11 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 12 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 13 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 14 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 15 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 16 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 17 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 18 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 19 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 20 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 21 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 22 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 23 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 24 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 25 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 26 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 27 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 28 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 29 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 30 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 31 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 32 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 33 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 34 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 35 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 36 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 37 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 38 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 39 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 40 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 41 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 42 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 43 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 44 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 45 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 46 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 47 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 48 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 49 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_021087 | 3300042612 | Bacteria | 4888 |
| 2 | Ga0466705_215137 | 3300042612 | Bacteria | 11074 |
| 3 | Ga0466691_165009 | 3300042593 | Bacteria | 7100 |
| 4 | Ga0466694_094371 | 3300042594 | Bacteria | 3023 |
| 5 | Ga0466694_302877 | 3300042594 | Bacteria | 9042 |
| 6 | Ga0466696_171899 | 3300042596 | Bacteria | 1038 |
| 7 | Ga0466699_162473 | 3300042597 | Bacteria | 1313 |
| 8 | Ga0466699_194592 | 3300042597 | Bacteria | 14989 |
| 9 | Ga0466699_197915 | 3300042597 | Bacteria | 1472 |
| 10 | Ga0466712_014472 | 3300042614 | Bacteria | 9134 |
| 11 | Ga0466712_069703 | 3300042614 | Bacteria | 18452 |
| 12 | Ga0466715_278161 | 3300042616 | Bacteria | 20583 |
| 13 | Ga0466718_005831 | 3300042617 | Bacteria | 1159 |
| 14 | Ga0466718_069589 | 3300042617 | Bacteria | 1148 |
| 15 | Ga0466718_083674 | 3300042617 | Bacteria | 23117 |
| 16 | Ga0466718_095194 | 3300042617 | Bacteria | 1143 |
| 17 | Ga0466729_094931 | 3300042621 | Bacteria | 1254 |
| 18 | Ga0466714_161619 | 3300042603 | Bacteria | 1960 |
| 19 | Ga0466720_113265 | 3300042607 | Bacteria | 14114 |
| 20 | Ga0466720_191443 | 3300042607 | Bacteria | 13873 |
| 21 | Ga0466698_130417 | 3300042610 | Bacteria | 1923 |
| 22 | JGI24698J34947_10009705 | 3300002449 | Bacteria | 5275 |
| 23 | JGI24698J34947_10032980 | 3300002449 | Bacteria | 2718 |
| 24 | JGI24698J34947_10046532 | 3300002449 | Unclassified | 2206 |
| 25 | Ga0072941_1002929 | 3300005201 | Bacteria | 20203 |
| 26 | Ga0072941_1020242 | 3300005201 | Bacteria | 7300 |
| 27 | Ga0072941_1028924 | 3300005201 | Bacteria | 22610 |
| 28 | Ga0072941_1085617 | 3300005201 | Bacteria | 4328 |
| 29 | Ga0466731_061986 | 3300042622 | Bacteria | 6258 |
| 30 | Ga0466709_100435 | 3300042648 | Bacteria | 13487 |
| 31 | Ga0466708_155249 | 3300042652 | Bacteria | 1660 |
| 32 | Ga0466732_268743 | 3300042656 | Bacteria | 78134 |
| 33 | Ga0466690_116002 | 3300042590 | Bacteria | 6393 |
| 34 | Ga0466692_004401 | 3300042591 | Bacteria | 5895 |
| 35 | Ga0466694_017861 | 3300042594 | Bacteria | 2509 |
| 36 | Ga0466694_099577 | 3300042594 | Bacteria | 97987 |
| 37 | Ga0466694_285590 | 3300042594 | Bacteria | 10196 |
| 38 | Ga0466712_069499 | 3300042614 | Bacteria | 9654 |
| 39 | Ga0466712_166964 | 3300042614 | Bacteria | 2168 |
| 40 | Ga0466723_327775 | 3300042618 | Bacteria | 4229 |
| 41 | Ga0466720_036409 | 3300042607 | Bacteria | 10791 |
| 42 | Ga0466720_086835 | 3300042607 | Bacteria | 11955 |
| 43 | JGI24698J34947_10078097 | 3300002449 | Bacteria | 1563 |
| 44 | JGI24698J34947_10183832 | 3300002449 | Bacteria | 833 |
| 45 | Ga0072941_1022529 | 3300005201 | Bacteria | 5606 |
| 46 | Ga0466704_222603 | 3300042643 | Bacteria | 60546 |
| 47 | Ga0466705_100797 | 3300042612 | Bacteria | 8618 |
| 48 | Ga0255786_1010291 | 3300022815 | Bacteria | 1892 |
| 49 | Ga0466694_278652 | 3300042594 | Bacteria | 1804 |
| 50 | Ga0466699_008647 | 3300042597 | Bacteria | 9849 |
| 51 | Ga0466699_240556 | 3300042597 | Bacteria | 1522 |
| 52 | Ga0466712_308194 | 3300042614 | Bacteria | 1426 |
| 53 | Ga0466718_038096 | 3300042617 | Bacteria | 2118 |
| 54 | Ga0466718_040373 | 3300042617 | Bacteria | 43603 |
| 55 | Ga0466719_121021 | 3300042606 | Bacteria | 1072 |
| 56 | Ga0466720_229889 | 3300042607 | Bacteria | 1603 |
| 57 | Ga0466722_127947 | 3300042609 | Bacteria | 11085 |
| 58 | AustNasuHG_c1001336 | 3300000089 | Bacteria | 8848 |
| 59 | JGI24698J34947_10014631 | 3300002449 | Bacteria | 4274 |
| 60 | JGI24698J34947_10030145 | 3300002449 | Bacteria | 2862 |
| 61 | JGI24698J34947_10162769 | 3300002449 | Bacteria | 912 |
| 62 | JGI24698J34947_10181836 | 3300002449 | Bacteria | 840 |
| 63 | JGI24698J34947_10214347 | 3300002449 | Bacteria | 743 |
| 64 | Ga0466694_235691 | 3300042594 | Bacteria | 3103 |
| 65 | Ga0466694_384865 | 3300042594 | Bacteria | 1658 |
| 66 | Ga0466699_096850 | 3300042597 | Bacteria | 7278 |
| 67 | Ga0466699_101990 | 3300042597 | Bacteria | 5399 |
| 68 | Ga0466699_196283 | 3300042597 | Bacteria | 2209 |
| 69 | Ga0466699_238817 | 3300042597 | Bacteria | 1341 |
| 70 | Ga0466699_289267 | 3300042597 | Bacteria | 1115 |
| 71 | Ga0466699_398223 | 3300042597 | Bacteria | 1295 |
| 72 | Ga0466712_024611 | 3300042614 | Bacteria | 1686 |
| 73 | Ga0466712_088678 | 3300042614 | Bacteria | 9635 |
| 74 | Ga0466712_146493 | 3300042614 | Bacteria | 1015 |
| 75 | Ga0466715_146130 | 3300042616 | Bacteria | 8286 |
| 76 | Ga0466700_183005 | 3300042600 | Bacteria | 1424 |
| 77 | Ga0466720_065010 | 3300042607 | Bacteria | 5217 |
| 78 | Ga0466720_124172 | 3300042607 | Bacteria | 14420 |
| 79 | AustNasuHG_c1000642 | 3300000089 | Bacteria | 12343 |
| 80 | JGI24698J34947_10028223 | 3300002449 | Bacteria | 2973 |
| 81 | Ga0074263_111222 | 3300005485 | Bacteria | 2152 |
| 82 | Ga0123356_11882349 | 3300010049 | Bacteria | 745 |
| 83 | Ga0123353_12547461 | 3300010167 | Bacteria | 607 |
| 84 | Ga0466694_152514 | 3300042594 | Bacteria | 2093 |
| 85 | Ga0466694_176662 | 3300042594 | Bacteria | 4740 |
| 86 | Ga0466699_048573 | 3300042597 | Bacteria | 4513 |
| 87 | Ga0466699_087020 | 3300042597 | Bacteria | 18921 |
| 88 | Ga0466699_221386 | 3300042597 | Bacteria | 8443 |
| 89 | Ga0466699_306292 | 3300042597 | Bacteria | 3499 |
| 90 | Ga0466712_062259 | 3300042614 | Bacteria | 5331 |
| 91 | Ga0466712_089511 | 3300042614 | Bacteria | 1274 |
| 92 | Ga0466712_107891 | 3300042614 | Bacteria | 6994 |
| 93 | Ga0466718_026594 | 3300042617 | Bacteria | 8284 |
| 94 | Ga0466718_031080 | 3300042617 | Bacteria | 3147 |
| 95 | Ga0466718_108716 | 3300042617 | Bacteria | 2425 |
| 96 | Ga0466718_132440 | 3300042617 | Bacteria | 2954 |
| 97 | Ga0466700_363661 | 3300042600 | Bacteria | 1115 |
| 98 | Ga0466722_009352 | 3300042609 | Bacteria | 5242 |
| 99 | Ga0466722_226697 | 3300042609 | Bacteria | 4911 |
| 100 | AustNasuHG_c1025645 | 3300000089 | Bacteria | 1848 |
| 101 | JGI24698J34947_10007156 | 3300002449 | Bacteria | 6132 |
| 102 | JGI24698J34947_10031775 | 3300002449 | Bacteria | 2776 |
| 103 | JGI24698J34947_10040697 | 3300002449 | Bacteria | 2398 |
| 104 | JGI24698J34947_10048129 | 3300002449 | Bacteria | 2161 |
| 105 | JGI24702J35022_10177773 | 3300002462 | Bacteria | 1207 |
| 106 | Ga0072941_1007260 | 3300005201 | Bacteria | 3452 |
| 107 | Ga0072941_1020502 | 3300005201 | Bacteria | 2453 |
| 108 | Ga0074263_104224 | 3300005485 | Bacteria | 3790 |
| 109 | Ga0123353_10363715 | 3300010167 | Bacteria | 2173 |
| 110 | Ga0466735_235066 | 3300042624 | Bacteria | 22324 |
| 111 | Ga0466702_349455 | 3300042635 | Bacteria | 1623 |
| 112 | Ga0466703_111906 | 3300042636 | Bacteria | 7822 |
| 113 | Ga0415639_037690 | 3300038395 | Bacteria | 8764 |
| 114 | Ga0466691_015410 | 3300042593 | Bacteria | 9318 |
| 115 | Ga0466694_017226 | 3300042594 | Bacteria | 1739 |
| 116 | Ga0466694_062678 | 3300042594 | Bacteria | 8128 |
| 117 | Ga0466699_049494 | 3300042597 | Bacteria | 4831 |
| 118 | Ga0466699_115293 | 3300042597 | Bacteria | 8221 |
| 119 | Ga0466699_368539 | 3300042597 | Bacteria | 12753 |
| 120 | Ga0466712_026369 | 3300042614 | Bacteria | 22902 |
| 121 | Ga0466712_120808 | 3300042614 | Bacteria | 5176 |
| 122 | Ga0466712_174536 | 3300042614 | Bacteria | 7039 |
| 123 | Ga0466711_128498 | 3300042615 | Bacteria | 1860 |
| 124 | Ga0466715_126402 | 3300042616 | Bacteria | 5502 |
| 125 | Ga0466718_003117 | 3300042617 | Bacteria | 1887 |
| 126 | Ga0466723_251232 | 3300042618 | Bacteria | 1117 |
| 127 | Ga0466719_011324 | 3300042606 | Bacteria | 8580 |
| 128 | Ga0466720_014028 | 3300042607 | Bacteria | 15010 |
| 129 | Ga0466720_019756 | 3300042607 | Bacteria | 7580 |
| 130 | Ga0466720_069001 | 3300042607 | Bacteria | 13682 |
| 131 | Ga0466722_009922 | 3300042609 | Bacteria | 6854 |
| 132 | AustNasuHG_c1024593 | 3300000089 | Bacteria | 1905 |
| 133 | AustNasuHG_c1060914 | 3300000089 | Bacteria | 731 |
| 134 | JGI24698J34947_10000297 | 3300002449 | Bacteria | 21642 |
| 135 | JGI24698J34947_10001630 | 3300002449 | Bacteria | 11955 |
| 136 | JGI24698J34947_10011040 | 3300002449 | Bacteria | 4955 |
| 137 | JGI24698J34947_10013471 | 3300002449 | Bacteria | 4465 |
| 138 | JGI24698J34947_10037453 | 3300002449 | Unclassified | 2519 |
| 139 | JGI24698J34947_10038663 | 3300002449 | Unclassified | 2474 |
| 140 | JGI24702J35022_10007642 | 3300002462 | Bacteria | 6179 |
| 141 | JGI24697J35500_11258290 | 3300002507 | Bacteria | 2848 |
| 142 | Ga0072941_1105672 | 3300005201 | Bacteria | 2515 |
| 143 | Ga0123356_10009504 | 3300010049 | Bacteria | 9604 |
| 144 | Ga0123353_10010965 | 3300010167 | Bacteria | 12713 |
| 145 | Ga0466704_224994 | 3300042643 | Bacteria | 18385 |
| 146 | Ga0264413_100675 | 3300024493 | Bacteria | 52863 |
| 147 | Ga0466690_252570 | 3300042590 | Bacteria | 7252 |
| 148 | Ga0466694_262155 | 3300042594 | Bacteria | 1788 |
| 149 | Ga0466699_062700 | 3300042597 | Bacteria | 1248 |
| 150 | Ga0466712_078355 | 3300042614 | Bacteria | 1360 |
| 151 | Ga0466712_247150 | 3300042614 | Bacteria | 17667 |
| 152 | Ga0466712_259113 | 3300042614 | Bacteria | 2587 |
| 153 | Ga0466712_277501 | 3300042614 | Bacteria | 1086 |
| 154 | Ga0466718_043583 | 3300042617 | Bacteria | 7759 |
| 155 | Ga0466718_085497 | 3300042617 | Bacteria | 1113 |
| 156 | Ga0466718_158923 | 3300042617 | Bacteria | 3621 |
| 157 | Ga0466723_029921 | 3300042618 | Bacteria | 20400 |
| 158 | Ga0466723_067722 | 3300042618 | Bacteria | 2319 |
| 159 | Ga0466723_291340 | 3300042618 | Bacteria | 16931 |
| 160 | Ga0466700_184243 | 3300042600 | Bacteria | 1988 |
| 161 | Ga0466720_086898 | 3300042607 | Bacteria | 3128 |
| 162 | Ga0466720_087544 | 3300042607 | Bacteria | 3039 |
| 163 | Ga0466722_024730 | 3300042609 | Bacteria | 12941 |
| 164 | AustNasuHG_c1003933 | 3300000089 | Bacteria | 5352 |
| 165 | JGI24698J34947_10004171 | 3300002449 | Bacteria | 7850 |
| 166 | JGI24698J34947_10064723 | 3300002449 | Bacteria | 1786 |
| 167 | JGI24698J34947_10158683 | 3300002449 | Bacteria | 929 |
| 168 | Ga0072941_1002931 | 3300005201 | Bacteria | 16731 |
| 169 | Ga0072941_1046809 | 3300005201 | Bacteria | 9005 |
| 170 | Ga0466730_065217 | 3300042625 | Bacteria | 1540 |
| 171 | Ga0466709_291042 | 3300042648 | Bacteria | 2033 |
| 172 | Ga0466727_224666 | 3300042655 | Bacteria | 1141 |
| 173 | Ga0415639_091675 | 3300038395 | Bacteria | 2970 |
| 174 | Ga0466690_104032 | 3300042590 | Bacteria | 7822 |
| 175 | Ga0466699_008741 | 3300042597 | Bacteria | 1334 |
| 176 | Ga0466699_180067 | 3300042597 | Bacteria | 13967 |
| 177 | Ga0466699_282763 | 3300042597 | Bacteria | 1334 |
| 178 | Ga0466699_285116 | 3300042597 | Bacteria | 3723 |
| 179 | Ga0466712_125307 | 3300042614 | Bacteria | 2804 |
| 180 | Ga0466712_134585 | 3300042614 | Bacteria | 21924 |
| 181 | Ga0466718_075255 | 3300042617 | Bacteria | 21483 |
| 182 | Ga0466728_106884 | 3300042620 | Bacteria | 4105 |
| 183 | Ga0466720_049105 | 3300042607 | Bacteria | 14779 |
| 184 | Ga0466720_058801 | 3300042607 | Bacteria | 1278 |
| 185 | Ga0466722_120064 | 3300042609 | Bacteria | 13407 |
| 186 | JGI24698J34947_10011152 | 3300002449 | Bacteria | 4933 |
| 187 | JGI24695J34938_10008629 | 3300002450 | Bacteria | 5792 |
| 188 | JGI24702J35022_10001743 | 3300002462 | Unclassified | 13485 |
| 189 | Ga0072940_1025910 | 3300005200 | Bacteria | 5926 |
| 190 | Ga0072941_1036910 | 3300005201 | Bacteria | 6885 |
| 191 | Ga0123356_10028774 | 3300010049 | Bacteria | 5207 |
| 192 | Ga0123353_11230472 | 3300010167 | Bacteria | 979 |
| 193 | Ga0466702_286179 | 3300042635 | Bacteria | 6744 |
| 194 | Ga0466704_296929 | 3300042643 | Bacteria | 10872 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03885 | DUF327 | Protein of unknown function (DUF327) | 58 | 202 | 0.78 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.