Protein Family IF00497
Metagenome
Metatranscriptome
Isolate
191
Members
66
Samples
184
Scaffolds
99.63
Avg Length
Representative Sequence
- ID
- 3300002449|JGI24698J34947_10009386|JGI24698J34947_100093862
- Length
- 117 aa
- Sequence
- VKDIRRAEPYKKWFKKLKMEKIKTSKYDPAEDIETKEDVIAYLEAALEENDTEFLFKTLGYIARSKGMAQIAKELDLNREGLYVALSPQGNPSFITIARVLDNLGYRLSIQSKKAS*
Sample Types
Isolate
3.7%
Metagenome
95.8%
MAG
0.0%
Metatranscriptome
0.5%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
51.6%
Kalotermitidae
21.0%
Unclassified
16.1%
Termopsidae
6.5%
Rhinotermitidae
4.8%
Taxonomy
Archaea
1
Bacteria
149
Eukaryota
0
Viruses
0
Unclassified
41
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 2 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 3 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 7 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 8 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 9 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 10 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 11 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 12 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 13 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 14 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 15 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 16 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 17 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 18 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 19 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 20 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 21 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 22 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 23 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 24 | 2820021908 | Unclassified Spirochaetes Lab288P4bin6 | Isolate | Unclassified |
| 25 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 26 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 27 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 28 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 29 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 30 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 31 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 32 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 33 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 34 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 35 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 36 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 37 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 38 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 39 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 40 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 41 | 2228664003 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA | Metagenome | Termitidae |
| 42 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 43 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 44 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 45 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 46 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 47 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 48 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 49 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 50 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 51 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 52 | 3300021235 | Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA | Metatranscriptome | |
| 53 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 54 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 55 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 56 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 57 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 58 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 59 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 60 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 61 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 62 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 63 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 64 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 65 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 66 | 2820016619 | Unclassified Spirochaetes Nt197P3bin71 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24698J34947_10290290 | 3300002449 | Unclassified | 594 |
| 2 | JGI24702J35022_10033174 | 3300002462 | Bacteria | 2762 |
| 3 | JGI24702J35022_10044370 | 3300002462 | Unclassified | 2370 |
| 4 | Ga0466721_235990 | 3300042608 | Bacteria | 1167 |
| 5 | Ga0466698_456126 | 3300042610 | Bacteria | 4668 |
| 6 | Ga0466705_411517 | 3300042612 | Unclassified | 1166 |
| 7 | Ga0466712_070475 | 3300042614 | Bacteria | 2568 |
| 8 | Ga0466718_014436 | 3300042617 | Bacteria | 2241 |
| 9 | Ga0466718_028118 | 3300042617 | Unclassified | 2519 |
| 10 | Ga0466718_033410 | 3300042617 | Bacteria | 3153 |
| 11 | Ga0466726_293185 | 3300042619 | Bacteria | 1369 |
| 12 | Ga0466726_385868 | 3300042619 | Bacteria | 1578 |
| 13 | Ga0466728_034622 | 3300042620 | Bacteria | 7186 |
| 14 | Ga0123355_10208597 | 3300009826 | Bacteria | 2837 |
| 15 | Ga0123356_10002030 | 3300010049 | Bacteria | 21866 |
| 16 | Ga0123353_11689686 | 3300010167 | Bacteria | 794 |
| 17 | Ga0466731_359050 | 3300042622 | Bacteria | 15410 |
| 18 | Ga0466735_032110 | 3300042624 | Bacteria | 1107 |
| 19 | Ga0466703_063414 | 3300042636 | Bacteria | 4641 |
| 20 | Ga0466703_214299 | 3300042636 | Bacteria | 1002 |
| 21 | Ga0466704_336498 | 3300042643 | Bacteria | 1021 |
| 22 | Ga0466727_267518 | 3300042655 | Bacteria | 1620 |
| 23 | Ga0466733_015627 | 3300042659 | Bacteria | 1142 |
| 24 | AustNasuHG_c1004801 | 3300000089 | Bacteria | 4839 |
| 25 | JGI24698J34947_10000918 | 3300002449 | Bacteria | 14951 |
| 26 | JGI24698J34947_10002887 | 3300002449 | Unclassified | 9314 |
| 27 | JGI24698J34947_10032517 | 3300002449 | Bacteria | 2739 |
| 28 | JGI24698J34947_10068269 | 3300002449 | Bacteria | 1720 |
| 29 | JGI24698J34947_10075939 | 3300002449 | Bacteria | 1595 |
| 30 | JGI24695J34938_10009696 | 3300002450 | Bacteria | 5336 |
| 31 | JGI24695J34938_10023559 | 3300002450 | Bacteria | 2967 |
| 32 | JGI24702J35022_10044247 | 3300002462 | Unclassified | 2372 |
| 33 | Ga0072940_1067646 | 3300005200 | Bacteria | 3316 |
| 34 | Ga0466690_124842 | 3300042590 | Unclassified | 2347 |
| 35 | Ga0466693_175657 | 3300042592 | Bacteria | 1603 |
| 36 | Ga0466694_174349 | 3300042594 | Bacteria | 93398 |
| 37 | Ga0466713_140346 | 3300042602 | Bacteria | 1630 |
| 38 | Ga0466720_097362 | 3300042607 | Unclassified | 2883 |
| 39 | Ga0466698_286554 | 3300042610 | Bacteria | 1104 |
| 40 | Ga0466712_009566 | 3300042614 | Bacteria | 5587 |
| 41 | Ga0466712_318471 | 3300042614 | Bacteria | 4851 |
| 42 | Ga0466718_046914 | 3300042617 | Bacteria | 2626 |
| 43 | Ga0466718_055605 | 3300042617 | Bacteria | 94458 |
| 44 | Ga0466718_141118 | 3300042617 | Bacteria | 2111 |
| 45 | Ga0466723_312187 | 3300042618 | Bacteria | 1284 |
| 46 | Ga0466726_408997 | 3300042619 | Bacteria | 3461 |
| 47 | Ga0123353_10791520 | 3300010167 | Bacteria | 1311 |
| 48 | Ga0466702_317956 | 3300042635 | Bacteria | 1476 |
| 49 | Ga0466732_177485 | 3300042656 | Bacteria | 1126 |
| 50 | FAAS_10432170 | 3300001880 | Bacteria | 600 |
| 51 | JGI24698J34947_10131638 | 3300002449 | Unclassified | 1068 |
| 52 | JGI24697J35500_10534728 | 3300002507 | Unclassified | 550 |
| 53 | JGI24699J35502_10777336 | 3300002509 | Bacteria | 850 |
| 54 | JGI24696J40584_12929812 | 3300002834 | Bacteria | 1459 |
| 55 | Ga0068302_10229965 | 3300005071 | Unclassified | 921 |
| 56 | Ga0466716_508576 | 3300042605 | Bacteria | 1207 |
| 57 | Ga0466719_162717 | 3300042606 | Bacteria | 1798 |
| 58 | Ga0466712_048694 | 3300042614 | Unclassified | 1013 |
| 59 | Ga0466712_107972 | 3300042614 | Bacteria | 1675 |
| 60 | Ga0466712_267773 | 3300042614 | Bacteria | 21070 |
| 61 | Ga0466712_316578 | 3300042614 | Unclassified | 3496 |
| 62 | Ga0466711_154026 | 3300042615 | Unclassified | 1782 |
| 63 | Ga0466718_038365 | 3300042617 | Unclassified | 1296 |
| 64 | Ga0466723_142806 | 3300042618 | Bacteria | 2268 |
| 65 | Ga0123356_11665838 | 3300010049 | Bacteria | 791 |
| 66 | Ga0466731_041100 | 3300042622 | Bacteria | 1109 |
| 67 | Ga0466731_239776 | 3300042622 | Bacteria | 1307 |
| 68 | Ga0466704_600918 | 3300042643 | Unclassified | 1914 |
| 69 | Ga0466709_370860 | 3300042648 | Bacteria | 7627 |
| 70 | Ga0466708_125287 | 3300042652 | Bacteria | 13791 |
| 71 | Ga0466727_004135 | 3300042655 | Bacteria | 5779 |
| 72 | 2230954195 | 2228664003 | Bacteria | 19731 |
| 73 | JGI24698J34947_10011785 | 3300002449 | Bacteria | 4801 |
| 74 | JGI24698J34947_10151614 | 3300002449 | Bacteria | 962 |
| 75 | JGI24698J34947_10254724 | 3300002449 | Unclassified | 654 |
| 76 | JGI24695J34938_10004787 | 3300002450 | Bacteria | 8713 |
| 77 | Ga0264413_117696 | 3300024493 | Bacteria | 19637 |
| 78 | Ga0264413_139416 | 3300024493 | Bacteria | 1214 |
| 79 | Ga0415639_038021 | 3300038395 | Bacteria | 6362 |
| 80 | Ga0415639_121348 | 3300038395 | Bacteria | 7551 |
| 81 | Ga0466690_395522 | 3300042590 | Unclassified | 1357 |
| 82 | Ga0466692_162078 | 3300042591 | Bacteria | 1132 |
| 83 | Ga0466693_043306 | 3300042592 | Bacteria | 5189 |
| 84 | Ga0466720_137118 | 3300042607 | Bacteria | 26537 |
| 85 | Ga0466721_063069 | 3300042608 | Unclassified | 1065 |
| 86 | Ga0466722_019938 | 3300042609 | Bacteria | 1017 |
| 87 | Ga0466718_006874 | 3300042617 | Bacteria | 4624 |
| 88 | Ga0466726_079224 | 3300042619 | Bacteria | 1417 |
| 89 | Ga0466728_157477 | 3300042620 | Bacteria | 1442 |
| 90 | Ga0466728_336151 | 3300042620 | Unclassified | 1111 |
| 91 | Ga0466731_084583 | 3300042622 | Bacteria | 1094 |
| 92 | Ga0466734_167750 | 3300042623 | Bacteria | 1039 |
| 93 | Ga0466704_525511 | 3300042643 | Bacteria | 1150 |
| 94 | Ga0466708_236357 | 3300042652 | Bacteria | 1276 |
| 95 | Ga0466708_418405 | 3300042652 | Unclassified | 1016 |
| 96 | Ga0466727_166708 | 3300042655 | Bacteria | 9244 |
| 97 | Ga0466727_251924 | 3300042655 | Bacteria | 1345 |
| 98 | Ga0466732_091135 | 3300042656 | Bacteria | 2883 |
| 99 | Ga0466732_239659 | 3300042656 | Bacteria | 2543 |
| 100 | JGI24698J34947_10003669 | 3300002449 | Bacteria | 8341 |
| 101 | JGI24698J34947_10037628 | 3300002449 | Bacteria | 2513 |
| 102 | JGI24698J34947_10066487 | 3300002449 | Bacteria | 1754 |
| 103 | JGI24698J34947_10208186 | 3300002449 | Unclassified | 760 |
| 104 | JGI24696J40584_12897208 | 3300002834 | Bacteria | 1163 |
| 105 | Ga0068305_10087550 | 3300005083 | Bacteria | 1418 |
| 106 | Ga0223674_1011386 | 3300021235 | Bacteria | 1474 |
| 107 | Ga0466716_376276 | 3300042605 | Bacteria | 1658 |
| 108 | Ga0466720_107539 | 3300042607 | Unclassified | 4634 |
| 109 | Ga0466718_164687 | 3300042617 | Unclassified | 2896 |
| 110 | Ga0466726_186347 | 3300042619 | Bacteria | 1331 |
| 111 | Ga0466726_256541 | 3300042619 | Bacteria | 1355 |
| 112 | Ga0466726_353447 | 3300042619 | Bacteria | 1055 |
| 113 | Ga0466726_412037 | 3300042619 | Bacteria | 3935 |
| 114 | Ga0466726_481817 | 3300042619 | Unclassified | 1303 |
| 115 | Ga0123353_11134890 | 3300010167 | Bacteria | 1033 |
| 116 | Ga0123353_13218819 | 3300010167 | Bacteria | 523 |
| 117 | Ga0466731_106649 | 3300042622 | Bacteria | 1061 |
| 118 | Ga0466708_186353 | 3300042652 | Unclassified | 4193 |
| 119 | Ga0466727_090751 | 3300042655 | Bacteria | 3275 |
| 120 | Ga0466727_248699 | 3300042655 | Bacteria | 1375 |
| 121 | Ga0466727_269971 | 3300042655 | Unclassified | 1344 |
| 122 | Ga0466732_084194 | 3300042656 | Bacteria | 1155 |
| 123 | Nasutiter_FTJKGMZ01CSJOK | 2030936001 | Unclassified | 555 |
| 124 | JGI24698J34947_10025412 | 3300002449 | Unclassified | 3152 |
| 125 | JGI24698J34947_10081999 | 3300002449 | Bacteria | 1509 |
| 126 | JGI24700J35501_10930738 | 3300002508 | Bacteria | 21095 |
| 127 | Ga0072941_1122637 | 3300005201 | Bacteria | 3348 |
| 128 | Ga0456237_0002664 | 3300041968 | Bacteria | 2881 |
| 129 | Ga0466657_161048 | 3300042582 | Bacteria | 1590 |
| 130 | Ga0466699_090317 | 3300042597 | Bacteria | 24950 |
| 131 | Ga0466707_140884 | 3300042601 | Bacteria | 1914 |
| 132 | Ga0466717_027856 | 3300042604 | Unclassified | 1521 |
| 133 | Ga0466717_096493 | 3300042604 | Bacteria | 1418 |
| 134 | Ga0466712_176267 | 3300042614 | Unclassified | 1090 |
| 135 | Ga0466712_270393 | 3300042614 | Unclassified | 2624 |
| 136 | Ga0466712_318000 | 3300042614 | Archaea | 1861 |
| 137 | Ga0466715_186086 | 3300042616 | Bacteria | 1725 |
| 138 | Ga0466718_031686 | 3300042617 | Bacteria | 1584 |
| 139 | Ga0466723_188868 | 3300042618 | Bacteria | 14355 |
| 140 | Ga0466726_205481 | 3300042619 | Bacteria | 1925 |
| 141 | Ga0466726_321132 | 3300042619 | Unclassified | 1559 |
| 142 | Ga0466728_066389 | 3300042620 | Bacteria | 3693 |
| 143 | Ga0123356_10205297 | 3300010049 | Bacteria | 2014 |
| 144 | Ga0466704_388698 | 3300042643 | Bacteria | 1264 |
| 145 | Ga0466727_146100 | 3300042655 | Bacteria | 1091 |
| 146 | Ga0466733_068092 | 3300042659 | Bacteria | 1984 |
| 147 | JGI24698J34947_10148184 | 3300002449 | Unclassified | 978 |
| 148 | JGI24698J34947_10189409 | 3300002449 | Bacteria | 815 |
| 149 | JGI24698J34947_10213547 | 3300002449 | Bacteria | 746 |
| 150 | JGI24695J34938_10044297 | 3300002450 | Bacteria | 1979 |
| 151 | Ga0466691_008165 | 3300042593 | Bacteria | 1329 |
| 152 | Ga0466699_070342 | 3300042597 | Bacteria | 4102 |
| 153 | Ga0466714_055383 | 3300042603 | Bacteria | 1919 |
| 154 | Ga0466720_225533 | 3300042607 | Bacteria | 6893 |
| 155 | Ga0466705_502558 | 3300042612 | Bacteria | 1004 |
| 156 | Ga0466712_028947 | 3300042614 | Unclassified | 1002 |
| 157 | Ga0466712_255373 | 3300042614 | Bacteria | 5491 |
| 158 | Ga0466726_168813 | 3300042619 | Bacteria | 1444 |
| 159 | Ga0123356_10559198 | 3300010049 | Unclassified | 1306 |
| 160 | Ga0123356_12277017 | 3300010049 | Bacteria | 677 |
| 161 | Ga0123353_10787419 | 3300010167 | Unclassified | 1316 |
| 162 | Ga0466708_273246 | 3300042652 | Unclassified | 1126 |
| 163 | Ga0466705_087566 | 3300042612 | Unclassified | 10466 |
| 164 | Ga0466733_078033 | 3300042659 | Unclassified | 5982 |
| 165 | JGI24698J34947_10009386 | 3300002449 | Bacteria | 5372 |
| 166 | JGI24698J34947_10179987 | 3300002449 | Bacteria | 846 |
| 167 | JGI24698J34947_10193273 | 3300002449 | Bacteria | 803 |
| 168 | Ga0072940_1026353 | 3300005200 | Unclassified | 2155 |
| 169 | Ga0264413_119998 | 3300024493 | Bacteria | 6895 |
| 170 | Ga0466690_052525 | 3300042590 | Bacteria | 1086 |
| 171 | Ga0466694_197002 | 3300042594 | Bacteria | 1913 |
| 172 | Ga0466719_328113 | 3300042606 | Bacteria | 2009 |
| 173 | Ga0466718_116695 | 3300042617 | Bacteria | 6017 |
| 174 | Ga0466726_300837 | 3300042619 | Bacteria | 1627 |
| 175 | Ga0123356_10004361 | 3300010049 | Bacteria | 14630 |
| 176 | Ga0123356_11766813 | 3300010049 | Bacteria | 768 |
| 177 | Ga0123356_12218938 | 3300010049 | Bacteria | 686 |
| 178 | Ga0123356_12632475 | 3300010049 | Bacteria | 630 |
| 179 | Ga0123353_11777153 | 3300010167 | Bacteria | 768 |
| 180 | Ga0123354_10012712 | 3300010882 | Bacteria | 13041 |
| 181 | Ga0466708_316316 | 3300042652 | Bacteria | 2032 |
| 182 | Ga0466708_335862 | 3300042652 | Bacteria | 28129 |
| 183 | Ga0466708_394495 | 3300042652 | Bacteria | 5724 |
| 184 | Ga0466727_345392 | 3300042655 | Bacteria | 1137 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300010167 | Ga0123353_10787419 | Ga0123353_107874193 | 95 |
| 2 | 3300042594 | Ga0466694_197002 | Ga0466694_197002_1367_1654 | 95 |
| 3 | 3300042617 | Ga0466718_006874 | Ga0466718_006874_1088_1375 | 95 |
| 4 | 3300042623 | Ga0466734_167750 | Ga0466734_167750_369_656 | 95 |
| 5 | 3300042636 | Ga0466703_063414 | Ga0466703_063414_1632_1919 | 95 |
| 6 | 3300042636 | Ga0466703_214299 | Ga0466703_214299_428_715 | 95 |
| 7 | 3300001880 | FAAS_10432170 | FAAS_104321701 | 96 |
| 8 | 3300002449 | JGI24698J34947_10081999 | JGI24698J34947_100819993 | 96 |
| 9 | 3300002449 | JGI24698J34947_10193273 | JGI24698J34947_101932731 | 96 |
| 10 | 3300002449 | JGI24698J34947_10208186 | JGI24698J34947_102081861 | 96 |
| 11 | 3300010049 | Ga0123356_11766813 | Ga0123356_117668132 | 96 |
| 12 | 3300010167 | Ga0123353_13218819 | Ga0123353_132188192 | 96 |
| 13 | 3300042593 | Ga0466691_008165 | Ga0466691_008165_497_787 | 96 |
| 14 | 3300042602 | Ga0466713_140346 | Ga0466713_140346_1201_1491 | 96 |
| 15 | 3300042615 | Ga0466711_154026 | Ga0466711_154026_1336_1626 | 96 |
| 16 | 3300042617 | Ga0466718_014436 | Ga0466718_014436_300_590 | 96 |
| 17 | 3300042652 | Ga0466708_236357 | Ga0466708_236357_647_937 | 96 |
| 18 | 3300042652 | Ga0466708_273246 | Ga0466708_273246_748_1038 | 96 |
| 19 | 3300042652 | Ga0466708_394495 | Ga0466708_394495_961_1251 | 96 |
| 20 | 3300042652 | Ga0466708_418405 | Ga0466708_418405_302_592 | 96 |
| 21 | 3300002462 | JGI24702J35022_10044247 | JGI24702J35022_100442472 | 97 |
| 22 | 3300002462 | JGI24702J35022_10044370 | JGI24702J35022_100443704 | 97 |
| 23 | 3300005083 | Ga0068305_10087550 | Ga0068305_100875501 | 97 |
| 24 | 3300041968 | Ga0456237_0002664 | Ga0456237_0002664_1415_1708 | 97 |
| 25 | 3300042590 | Ga0466690_124842 | Ga0466690_124842_1065_1358 | 97 |
| 26 | 3300042590 | Ga0466690_395522 | Ga0466690_395522_814_1107 | 97 |
| 27 | 3300042622 | Ga0466731_239776 | Ga0466731_239776_732_1025 | 97 |
| 28 | 3300010049 | Ga0123356_10205297 | Ga0123356_102052972 | 98 |
| 29 | 3300024493 | Ga0264413_117696 | Ga0264413_11769611 | 98 |
| 30 | 3300024493 | Ga0264413_119998 | Ga0264413_1199984 | 98 |
| 31 | 3300024493 | Ga0264413_139416 | Ga0264413_1394162 | 98 |
| 32 | 3300038395 | Ga0415639_038021 | Ga0415639_038021_1829_2125 | 98 |
| 33 | 3300042590 | Ga0466690_052525 | Ga0466690_052525_38_334 | 98 |
| 34 | 3300042591 | Ga0466692_162078 | Ga0466692_162078_630_926 | 98 |
| 35 | 3300042592 | Ga0466693_043306 | Ga0466693_043306_3681_3977 | 98 |
| 36 | 3300042597 | Ga0466699_070342 | Ga0466699_070342_2576_2872 | 98 |
| 37 | 3300042597 | Ga0466699_090317 | Ga0466699_090317_23687_23983 | 98 |
| 38 | 3300042601 | Ga0466707_140884 | Ga0466707_140884_1445_1741 | 98 |
| 39 | 3300042604 | Ga0466717_096493 | Ga0466717_096493_564_860 | 98 |
| 40 | 3300042605 | Ga0466716_376276 | Ga0466716_376276_1099_1395 | 98 |
| 41 | 3300042605 | Ga0466716_508576 | Ga0466716_508576_689_985 | 98 |
| 42 | 3300042607 | Ga0466720_097362 | Ga0466720_097362_1314_1610 | 98 |
| 43 | 3300042607 | Ga0466720_107539 | Ga0466720_107539_2970_3266 | 98 |
| 44 | 3300042607 | Ga0466720_137118 | Ga0466720_137118_23086_23382 | 98 |
| 45 | 3300042608 | Ga0466721_063069 | Ga0466721_063069_185_481 | 98 |
| 46 | 3300042608 | Ga0466721_235990 | Ga0466721_235990_551_847 | 98 |
| 47 | 3300042610 | Ga0466698_456126 | Ga0466698_456126_3686_3982 | 98 |
| 48 | 3300042612 | Ga0466705_087566 | Ga0466705_087566_9907_10203 | 98 |
| 49 | 3300042614 | Ga0466712_009566 | Ga0466712_009566_347_643 | 98 |
| 50 | 3300042614 | Ga0466712_028947 | Ga0466712_028947_428_724 | 98 |
| 51 | 3300042614 | Ga0466712_048694 | Ga0466712_048694_171_467 | 98 |
| 52 | 3300042614 | Ga0466712_070475 | Ga0466712_070475_1630_1926 | 98 |
| 53 | 3300042614 | Ga0466712_107972 | Ga0466712_107972_315_611 | 98 |
| 54 | 3300042614 | Ga0466712_176267 | Ga0466712_176267_509_805 | 98 |
| 55 | 3300042614 | Ga0466712_255373 | Ga0466712_255373_2110_2406 | 98 |
| 56 | 3300042614 | Ga0466712_267773 | Ga0466712_267773_7251_7547 | 98 |
| 57 | 3300042614 | Ga0466712_270393 | Ga0466712_270393_609_905 | 98 |
| 58 | 3300042614 | Ga0466712_316578 | Ga0466712_316578_2232_2528 | 98 |
| 59 | 3300042614 | Ga0466712_318000 | Ga0466712_318000_976_1272 | 98 |
| 60 | 3300042614 | Ga0466712_318471 | Ga0466712_318471_4417_4713 | 98 |
| 61 | 3300042616 | Ga0466715_186086 | Ga0466715_186086_233_529 | 98 |
| 62 | 3300042617 | Ga0466718_033410 | Ga0466718_033410_1173_1469 | 98 |
| 63 | 3300042617 | Ga0466718_038365 | Ga0466718_038365_321_617 | 98 |
| 64 | 3300042617 | Ga0466718_164687 | Ga0466718_164687_172_468 | 98 |
| 65 | 3300042618 | Ga0466723_142806 | Ga0466723_142806_1509_1805 | 98 |
| 66 | 3300042618 | Ga0466723_188868 | Ga0466723_188868_9793_10089 | 98 |
| 67 | 3300042619 | Ga0466726_168813 | Ga0466726_168813_1087_1383 | 98 |
| 68 | 3300042619 | Ga0466726_186347 | Ga0466726_186347_570_866 | 98 |
| 69 | 3300042619 | Ga0466726_300837 | Ga0466726_300837_235_531 | 98 |
| 70 | 3300042619 | Ga0466726_385868 | Ga0466726_385868_481_777 | 98 |
| 71 | 3300042619 | Ga0466726_408997 | Ga0466726_408997_188_484 | 98 |
| 72 | 3300042619 | Ga0466726_481817 | Ga0466726_481817_70_366 | 98 |
| 73 | 3300042620 | Ga0466728_034622 | Ga0466728_034622_2900_3196 | 98 |
| 74 | 3300042622 | Ga0466731_041100 | Ga0466731_041100_645_941 | 98 |
| 75 | 3300042622 | Ga0466731_359050 | Ga0466731_359050_12822_13118 | 98 |
| 76 | 3300042624 | Ga0466735_032110 | Ga0466735_032110_162_458 | 98 |
| 77 | 3300042635 | Ga0466702_317956 | Ga0466702_317956_790_1086 | 98 |
| 78 | 3300042643 | Ga0466704_525511 | Ga0466704_525511_46_342 | 98 |
| 79 | 3300042643 | Ga0466704_600918 | Ga0466704_600918_449_745 | 98 |
| 80 | 3300042648 | Ga0466709_370860 | Ga0466709_370860_254_550 | 98 |
| 81 | 3300042652 | Ga0466708_125287 | Ga0466708_125287_5151_5447 | 98 |
| 82 | 3300042652 | Ga0466708_186353 | Ga0466708_186353_490_786 | 98 |
| 83 | 3300042652 | Ga0466708_316316 | Ga0466708_316316_1650_1946 | 98 |
| 84 | 3300042652 | Ga0466708_335862 | Ga0466708_335862_2739_3035 | 98 |
| 85 | 3300042655 | Ga0466727_004135 | Ga0466727_004135_3053_3349 | 98 |
| 86 | 3300042655 | Ga0466727_166708 | Ga0466727_166708_5642_5938 | 98 |
| 87 | 3300042655 | Ga0466727_345392 | Ga0466727_345392_669_965 | 98 |
| 88 | 3300042656 | Ga0466732_177485 | Ga0466732_177485_243_539 | 98 |
| 89 | 3300042659 | Ga0466733_015627 | Ga0466733_015627_600_896 | 98 |
| 90 | 3300042659 | Ga0466733_078033 | Ga0466733_078033_4453_4749 | 98 |
| 91 | iso_pr_bacteria | 2781125645 | 2781299966 | 98 |
| 92 | iso_pr_bacteria | 2781125694 | 2781435765 | 98 |
| 93 | iso_pr_bacteria | 2820016619 | 2820016636 | 98 |
| 94 | iso_pr_bacteria | 2820021908 | 2820022253 | 98 |
| 95 | 3300000089 | AustNasuHG_c1004801 | AustNasuHG_10048017 | 99 |
| 96 | 3300002449 | JGI24698J34947_10000918 | JGI24698J34947_1000091812 | 99 |
| 97 | 3300002449 | JGI24698J34947_10002887 | JGI24698J34947_100028872 | 99 |
| 98 | 3300002449 | JGI24698J34947_10003669 | JGI24698J34947_100036696 | 99 |
| 99 | 3300002449 | JGI24698J34947_10011785 | JGI24698J34947_100117854 | 99 |
| 100 | 3300002449 | JGI24698J34947_10025412 | JGI24698J34947_100254122 | 99 |
| 101 | 3300002449 | JGI24698J34947_10032517 | JGI24698J34947_100325171 | 99 |
| 102 | 3300002449 | JGI24698J34947_10037628 | JGI24698J34947_100376283 | 99 |
| 103 | 3300002449 | JGI24698J34947_10066487 | JGI24698J34947_100664872 | 99 |
| 104 | 3300002449 | JGI24698J34947_10068269 | JGI24698J34947_100682694 | 99 |
| 105 | 3300002449 | JGI24698J34947_10075939 | JGI24698J34947_100759392 | 99 |
| 106 | 3300002449 | JGI24698J34947_10131638 | JGI24698J34947_101316382 | 99 |
| 107 | 3300002449 | JGI24698J34947_10148184 | JGI24698J34947_101481841 | 99 |
| 108 | 3300002449 | JGI24698J34947_10179987 | JGI24698J34947_101799871 | 99 |
| 109 | 3300002449 | JGI24698J34947_10189409 | JGI24698J34947_101894091 | 99 |
| 110 | 3300002449 | JGI24698J34947_10213547 | JGI24698J34947_102135471 | 99 |
| 111 | 3300002449 | JGI24698J34947_10254724 | JGI24698J34947_102547241 | 99 |
| 112 | 3300002449 | JGI24698J34947_10290290 | JGI24698J34947_102902902 | 99 |
| 113 | 3300002450 | JGI24695J34938_10004787 | JGI24695J34938_100047874 | 99 |
| 114 | 3300002450 | JGI24695J34938_10023559 | JGI24695J34938_100235597 | 99 |
| 115 | 3300002507 | JGI24697J35500_10534728 | JGI24697J35500_105347281 | 99 |
| 116 | 3300002509 | JGI24699J35502_10777336 | JGI24699J35502_107773362 | 99 |
| 117 | 3300002834 | JGI24696J40584_12897208 | JGI24696J40584_128972081 | 99 |
| 118 | 3300002834 | JGI24696J40584_12929812 | JGI24696J40584_129298122 | 99 |
| 119 | 3300005200 | Ga0072940_1067646 | Ga0072940_10676464 | 99 |
| 120 | 3300009826 | Ga0123355_10208597 | Ga0123355_102085973 | 99 |
| 121 | 3300010049 | Ga0123356_10002030 | Ga0123356_100020307 | 99 |
| 122 | 3300010049 | Ga0123356_10004361 | Ga0123356_1000436112 | 99 |
| 123 | 3300010049 | Ga0123356_10559198 | Ga0123356_105591983 | 99 |
| 124 | 3300010049 | Ga0123356_11665838 | Ga0123356_116658381 | 99 |
| 125 | 3300010049 | Ga0123356_12218938 | Ga0123356_122189381 | 99 |
| 126 | 3300010049 | Ga0123356_12277017 | Ga0123356_122770171 | 99 |
| 127 | 3300010049 | Ga0123356_12632475 | Ga0123356_126324751 | 99 |
| 128 | 3300010167 | Ga0123353_10791520 | Ga0123353_107915202 | 99 |
| 129 | 3300010167 | Ga0123353_11134890 | Ga0123353_111348902 | 99 |
| 130 | 3300010167 | Ga0123353_11689686 | Ga0123353_116896862 | 99 |
| 131 | 3300010167 | Ga0123353_11777153 | Ga0123353_117771532 | 99 |
| 132 | 3300010882 | Ga0123354_10012712 | Ga0123354_100127129 | 99 |
| 133 | 3300042617 | Ga0466718_046914 | Ga0466718_046914_1167_1466 | 99 |
| 134 | 3300042619 | Ga0466726_256541 | Ga0466726_256541_854_1153 | 99 |
| 135 | 3300042619 | Ga0466726_353447 | Ga0466726_353447_587_886 | 99 |
| 136 | 3300042622 | Ga0466731_106649 | Ga0466731_106649_516_815 | 99 |
| 137 | 3300042659 | Ga0466733_068092 | Ga0466733_068092_983_1282 | 99 |
| 138 | iso_pr_bacteria | 2781125695 | 2781439774 | 99 |
| 139 | 3300002462 | JGI24702J35022_10033174 | JGI24702J35022_100331747 | 100 |
| 140 | 3300042603 | Ga0466714_055383 | Ga0466714_055383_138_440 | 100 |
| 141 | 3300042655 | Ga0466727_090751 | Ga0466727_090751_1528_1830 | 100 |
| 142 | 3300042655 | Ga0466727_251924 | Ga0466727_251924_146_448 | 100 |
| 143 | iso_pr_bacteria | 2781125682 | 2781408833 | 100 |
| 144 | 3300005071 | Ga0068302_10229965 | Ga0068302_102299651 | 101 |
| 145 | 3300042606 | Ga0466719_162717 | Ga0466719_162717_597_902 | 101 |
| 146 | 3300042606 | Ga0466719_328113 | Ga0466719_328113_1567_1872 | 101 |
| 147 | 3300042619 | Ga0466726_079224 | Ga0466726_079224_627_932 | 101 |
| 148 | 3300042620 | Ga0466728_157477 | Ga0466728_157477_368_673 | 101 |
| 149 | 3300042643 | Ga0466704_336498 | Ga0466704_336498_492_797 | 101 |
| 150 | 3300042592 | Ga0466693_175657 | Ga0466693_175657_346_654 | 102 |
| 151 | 3300042612 | Ga0466705_411517 | Ga0466705_411517_207_515 | 102 |
| 152 | 3300042612 | Ga0466705_502558 | Ga0466705_502558_40_348 | 102 |
| 153 | 3300042618 | Ga0466723_312187 | Ga0466723_312187_127_435 | 102 |
| 154 | 3300042619 | Ga0466726_412037 | Ga0466726_412037_178_486 | 102 |
| 155 | 3300042620 | Ga0466728_066389 | Ga0466728_066389_2339_2647 | 102 |
| 156 | 2030936001 | Nasutiter_FTJKGMZ01CSJOK | Nasutiterm_1284050 | 103 |
| 157 | 2228664003 | 2230954195 | 2230659544 | 103 |
| 158 | 3300005201 | Ga0072941_1122637 | Ga0072941_11226373 | 103 |
| 159 | 3300021235 | Ga0223674_1011386 | Ga0223674_10113862 | 103 |
| 160 | 3300042582 | Ga0466657_161048 | Ga0466657_161048_492_803 | 103 |
| 161 | 3300042617 | Ga0466718_028118 | Ga0466718_028118_1997_2308 | 103 |
| 162 | 3300042617 | Ga0466718_055605 | Ga0466718_055605_40777_41088 | 103 |
| 163 | 3300042617 | Ga0466718_116695 | Ga0466718_116695_1832_2143 | 103 |
| 164 | 3300042619 | Ga0466726_205481 | Ga0466726_205481_555_866 | 103 |
| 165 | 3300042622 | Ga0466731_084583 | Ga0466731_084583_246_557 | 103 |
| 166 | 3300042655 | Ga0466727_269971 | Ga0466727_269971_886_1197 | 103 |
| 167 | 3300042656 | Ga0466732_084194 | Ga0466732_084194_595_906 | 103 |
| 168 | 3300042656 | Ga0466732_091135 | Ga0466732_091135_1384_1695 | 103 |
| 169 | 3300042656 | Ga0466732_239659 | Ga0466732_239659_171_482 | 103 |
| 170 | iso_pr_bacteria | 2819994798 | 2819997261 | 103 |
| 171 | 3300002450 | JGI24695J34938_10009696 | JGI24695J34938_100096963 | 104 |
| 172 | 3300002450 | JGI24695J34938_10044297 | JGI24695J34938_100442972 | 104 |
| 173 | 3300002508 | JGI24700J35501_10930738 | JGI24700J35501_1093073810 | 104 |
| 174 | 3300042604 | Ga0466717_027856 | Ga0466717_027856_104_418 | 104 |
| 175 | 3300005200 | Ga0072940_1026353 | Ga0072940_10263531 | 105 |
| 176 | 3300042619 | Ga0466726_321132 | Ga0466726_321132_651_968 | 105 |
| 177 | 3300002449 | JGI24698J34947_10151614 | JGI24698J34947_101516142 | 106 |
| 178 | 3300042620 | Ga0466728_336151 | Ga0466728_336151_547_867 | 106 |
| 179 | 3300042655 | Ga0466727_248699 | Ga0466727_248699_80_400 | 106 |
| 180 | 3300042655 | Ga0466727_267518 | Ga0466727_267518_1060_1380 | 106 |
| 181 | 3300038395 | Ga0415639_121348 | Ga0415639_121348_7073_7396 | 107 |
| 182 | 3300042617 | Ga0466718_031686 | Ga0466718_031686_1230_1553 | 107 |
| 183 | 3300042619 | Ga0466726_293185 | Ga0466726_293185_822_1145 | 107 |
| 184 | 3300042609 | Ga0466722_019938 | Ga0466722_019938_314_640 | 108 |
| 185 | 3300042643 | Ga0466704_388698 | Ga0466704_388698_414_740 | 108 |
| 186 | 3300042594 | Ga0466694_174349 | Ga0466694_174349_69971_70300 | 109 |
| 187 | 3300042607 | Ga0466720_225533 | Ga0466720_225533_5953_6282 | 109 |
| 188 | 3300042617 | Ga0466718_141118 | Ga0466718_141118_727_1056 | 109 |
| 189 | 3300042655 | Ga0466727_146100 | Ga0466727_146100_79_408 | 109 |
| 190 | 3300042610 | Ga0466698_286554 | Ga0466698_286554_585_920 | 111 |
| 191 | 3300002449 | JGI24698J34947_10009386 | JGI24698J34947_100093862 | 117 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF21716 | dnstrm_HI1420 | Probable addiction module antidote protein | 24 | 111 | 0.97 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.55 | 0.68 | Medium |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.