Protein Family IF00479
Metagenome
Isolate
225
Members
80
Samples
193
Scaffolds
584.4
Avg Length
Representative Sequence
- ID
- 3300002449|JGI24698J34947_10002943|JGI24698J34947_100029436
- Length
- 624 aa
- Sequence
- MALLDKYLPKTEFESYEDFYKNFTVNIPENFNFAYDVVDALAQEKPNERALQWCDEKGAEAVFTYAEMRDYSNKAANVLREAGIGKGDPIMLILKRRWEYWPVILALHKLGAIAIPATHLLTTKDLVYRCNAADIKGIICVDDHDLMYRVDEAEAIMERSAESHGLSQLRYKAFVRSVHTPKDHDPAQVAKELLAERTKKEYFTDPFSGSITDGPVGVFGAFAGAETGFPMPEPLLSWTDFGPLLEGASNDLKDAKRVNANSDIMLLYFTSGTTGMPKMVRHDFTYPLGHVATAKYWHHVIPEGLHLTVADTGWAKAAWGCIYGQWLCGAGIFVYDYDRFVPAAMLEVISKYRLTSFCAPPTIYRFFIKEDLKKYDFSPLQTCSVAGEPLNPEIFDKFLAGTGLKLRECYGQTELTVTLCAWPWLAPKPGSMGKPAPGYDIDLLREDGTSCGMGEEGQIVVRTGKSKPWGMFGGYFRDNALTNSVWHDDIYYTGDVAWKDEDGYFWFVGRNDDVIKSSGYRIGPFEVESALMEHPAVLECAITGFPDPDRGTVVXATVVLAKKFTASEELKXELQNHVKKTTAPYKYPRIVEFVNELPKTISGKIRRVQIREENTNTKENDNE*
Sample Types
Isolate
14.2%
Metagenome
85.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
39.7%
Termitidae
33.3%
Kalotermitidae
17.9%
Rhinotermitidae
3.8%
Termopsidae
1.3%
Blattidae
1.3%
Hodotermitidae
1.3%
Tenebrionidae
1.3%
Taxonomy
Archaea
4
Bacteria
207
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 2 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 3 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 4 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 5 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 6 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 7 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 8 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 9 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 10 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 11 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 12 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 13 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 14 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 15 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 16 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 17 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 18 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 19 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 20 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 21 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 22 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 23 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 24 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 25 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 26 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 27 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 28 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 29 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 30 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 31 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 32 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 33 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 34 | 2820261600 | Unclassified Firmicutes Th196P3bin40 | Isolate | Unclassified |
| 35 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 36 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 37 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 38 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 39 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 40 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 41 | 2820275298 | Unclassified Firmicutes Th196P3bin17 | Isolate | Unclassified |
| 42 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 43 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 44 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 45 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 46 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 47 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 48 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 49 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 50 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 51 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 52 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 53 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 54 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 55 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 56 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 57 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 58 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 59 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 60 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 61 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 62 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 63 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 64 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 65 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 66 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 67 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 68 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 69 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 70 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 71 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 72 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 73 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 74 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 75 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 76 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 77 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 78 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 79 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 80 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466712_023972 | 3300042614 | Bacteria | 40905 |
| 2 | Ga0466712_057302 | 3300042614 | Bacteria | 15850 |
| 3 | Ga0466712_243304 | 3300042614 | Bacteria | 8237 |
| 4 | Ga0466715_298109 | 3300042616 | Bacteria | 6354 |
| 5 | Ga0466715_314613 | 3300042616 | Bacteria | 12172 |
| 6 | Ga0466718_028006 | 3300042617 | Bacteria | 5420 |
| 7 | Ga0466723_006825 | 3300042618 | Bacteria | 6477 |
| 8 | Ga0466728_306748 | 3300042620 | Bacteria | 24885 |
| 9 | Ga0123356_10001258 | 3300010049 | Bacteria | 28039 |
| 10 | Ga0123356_10030322 | 3300010049 | Unclassified | 5063 |
| 11 | Ga0123356_10049263 | 3300010049 | Bacteria | 3921 |
| 12 | JGI24698J34947_10001373 | 3300002449 | Bacteria | 12797 |
| 13 | JGI24695J34938_10000168 | 3300002450 | Bacteria | 61343 |
| 14 | JGI24695J34938_10000327 | 3300002450 | Bacteria | 46825 |
| 15 | JGI24695J34938_10022244 | 3300002450 | Unclassified | 3082 |
| 16 | Ga0072941_1000772 | 3300005201 | Bacteria | 15980 |
| 17 | Ga0466691_149368 | 3300042593 | Bacteria | 14091 |
| 18 | Ga0466694_099577 | 3300042594 | Bacteria | 97987 |
| 19 | Ga0466713_034595 | 3300042602 | Bacteria | 5899 |
| 20 | Ga0466721_191339 | 3300042608 | Bacteria | 79638 |
| 21 | Ga0466705_382978 | 3300042612 | Bacteria | 7803 |
| 22 | Ga0466703_076111 | 3300042636 | Bacteria | 5098 |
| 23 | Ga0466703_263084 | 3300042636 | Bacteria | 13787 |
| 24 | Ga0466703_278593 | 3300042636 | Bacteria | 8343 |
| 25 | Ga0466727_135445 | 3300042655 | Bacteria | 21242 |
| 26 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 27 | Ga0466712_186982 | 3300042614 | Bacteria | 19939 |
| 28 | Ga0123356_10001863 | 3300010049 | Bacteria | 22834 |
| 29 | Ga0123356_10038009 | 3300010049 | Archaea | 4488 |
| 30 | JGI24698J34947_10000723 | 3300002449 | Bacteria | 16260 |
| 31 | JGI24698J34947_10004019 | 3300002449 | Bacteria | 7997 |
| 32 | JGI24695J34938_10003380 | 3300002450 | Bacteria | 11208 |
| 33 | JGI24695J34938_10024672 | 3300002450 | Bacteria | 2885 |
| 34 | JGI24702J35022_10004702 | 3300002462 | Bacteria | 8087 |
| 35 | Ga0072941_1006283 | 3300005201 | Bacteria | 68986 |
| 36 | Ga0264413_100027 | 3300024493 | Bacteria | 30442 |
| 37 | Ga0466699_076641 | 3300042597 | Bacteria | 8576 |
| 38 | Ga0466719_352413 | 3300042606 | Bacteria | 12070 |
| 39 | Ga0466722_056359 | 3300042609 | Bacteria | 10809 |
| 40 | Ga0466705_308964 | 3300042612 | Bacteria | 4064 |
| 41 | Ga0466704_288257 | 3300042643 | Bacteria | 7368 |
| 42 | Ga0466704_290233 | 3300042643 | Bacteria | 3233 |
| 43 | Ga0466704_474466 | 3300042643 | Bacteria | 14052 |
| 44 | Ga0466709_153140 | 3300042648 | Unclassified | 3465 |
| 45 | Ga0466708_006128 | 3300042652 | Bacteria | 1536 |
| 46 | Ga0466708_211014 | 3300042652 | Bacteria | 28441 |
| 47 | Ga0466708_213576 | 3300042652 | Bacteria | 3714 |
| 48 | Ga0466711_020730 | 3300042615 | Bacteria | 25334 |
| 49 | Ga0466711_120457 | 3300042615 | Bacteria | 5517 |
| 50 | Ga0466715_118861 | 3300042616 | Bacteria | 20979 |
| 51 | Ga0123356_10000072 | 3300010049 | Bacteria | 106738 |
| 52 | Ga0123354_10063317 | 3300010882 | Bacteria | 5436 |
| 53 | AustNasuHG_c1000394 | 3300000089 | Bacteria | 15184 |
| 54 | JGI24698J34947_10009934 | 3300002449 | Bacteria | 5217 |
| 55 | JGI24698J34947_10010590 | 3300002449 | Bacteria | 5061 |
| 56 | JGI24695J34938_10000233 | 3300002450 | Bacteria | 52947 |
| 57 | JGI24695J34938_10000964 | 3300002450 | Bacteria | 26239 |
| 58 | JGI24695J34938_10006442 | 3300002450 | Bacteria | 7046 |
| 59 | JGI24695J34938_10009915 | 3300002450 | Bacteria | 5260 |
| 60 | JGI24695J34938_10022988 | 3300002450 | Bacteria | 3013 |
| 61 | JGI24695J34938_10026864 | 3300002450 | Unclassified | 2730 |
| 62 | JGI24702J35022_10015672 | 3300002462 | Bacteria | 4164 |
| 63 | Ga0072940_1003958 | 3300005200 | Unclassified | 7324 |
| 64 | Ga0072940_1018285 | 3300005200 | Bacteria | 17870 |
| 65 | Ga0415639_006160 | 3300038395 | Bacteria | 7975 |
| 66 | Ga0415639_037257 | 3300038395 | Bacteria | 8685 |
| 67 | Ga0466690_064068 | 3300042590 | Bacteria | 10754 |
| 68 | Ga0466699_102031 | 3300042597 | Bacteria | 2927 |
| 69 | Ga0466700_437076 | 3300042600 | Bacteria | 5519 |
| 70 | Ga0466720_019519 | 3300042607 | Unclassified | 3874 |
| 71 | Ga0466698_014214 | 3300042610 | Bacteria | 17428 |
| 72 | Ga0466705_008895 | 3300042612 | Bacteria | 6848 |
| 73 | Ga0466705_260067 | 3300042612 | Bacteria | 32862 |
| 74 | Ga0466709_063956 | 3300042648 | Bacteria | 51970 |
| 75 | Ga0466727_346587 | 3300042655 | Bacteria | 7569 |
| 76 | Ga0466705_466814 | 3300042612 | Bacteria | 10542 |
| 77 | Ga0466712_105082 | 3300042614 | Bacteria | 28950 |
| 78 | Ga0466712_204936 | 3300042614 | Bacteria | 15010 |
| 79 | Ga0466715_447808 | 3300042616 | Unclassified | 1630 |
| 80 | Ga0466718_002660 | 3300042617 | Bacteria | 15942 |
| 81 | Ga0466718_049578 | 3300042617 | Bacteria | 7575 |
| 82 | Ga0123356_10001481 | 3300010049 | Bacteria | 25858 |
| 83 | JGI24698J34947_10000986 | 3300002449 | Bacteria | 14584 |
| 84 | JGI24698J34947_10004049 | 3300002449 | Bacteria | 7962 |
| 85 | JGI24695J34938_10002429 | 3300002450 | Bacteria | 14283 |
| 86 | JGI24695J34938_10002848 | 3300002450 | Bacteria | 12609 |
| 87 | Ga0415639_001101 | 3300038395 | Bacteria | 6052 |
| 88 | Ga0415639_085091 | 3300038395 | Bacteria | 2638 |
| 89 | Ga0466691_088801 | 3300042593 | Bacteria | 15036 |
| 90 | Ga0466691_103000 | 3300042593 | Unclassified | 8854 |
| 91 | Ga0466694_155074 | 3300042594 | Bacteria | 7462 |
| 92 | Ga0466696_109139 | 3300042596 | Bacteria | 8969 |
| 93 | Ga0466700_291775 | 3300042600 | Bacteria | 2931 |
| 94 | Ga0466731_113252 | 3300042622 | Bacteria | 17419 |
| 95 | Ga0466704_603185 | 3300042643 | Bacteria | 21919 |
| 96 | Ga0466708_170486 | 3300042652 | Bacteria | 6548 |
| 97 | Ga0466708_357081 | 3300042652 | Bacteria | 48632 |
| 98 | Ga0123356_10001619 | 3300010049 | Bacteria | 24675 |
| 99 | Ga0123356_10002023 | 3300010049 | Archaea | 21906 |
| 100 | Ga0123356_10008145 | 3300010049 | Bacteria | 10436 |
| 101 | Ga0123356_10168215 | 3300010049 | Archaea | 2199 |
| 102 | Ga0123353_10243615 | 3300010167 | Bacteria | 2791 |
| 103 | Ga0072941_1002114 | 3300005201 | Archaea | 20188 |
| 104 | Ga0264413_110456 | 3300024493 | Bacteria | 6664 |
| 105 | Ga0466696_460146 | 3300042596 | Bacteria | 25654 |
| 106 | Ga0466719_267735 | 3300042606 | Bacteria | 3166 |
| 107 | Ga0466720_019995 | 3300042607 | Bacteria | 6432 |
| 108 | Ga0466720_100369 | 3300042607 | Bacteria | 11934 |
| 109 | Ga0466721_386169 | 3300042608 | Bacteria | 3072 |
| 110 | Ga0466705_116573 | 3300042612 | Bacteria | 6049 |
| 111 | Ga0466709_417886 | 3300042648 | Bacteria | 12703 |
| 112 | Ga0466712_047244 | 3300042614 | Bacteria | 23597 |
| 113 | Ga0466712_166358 | 3300042614 | Bacteria | 6060 |
| 114 | Ga0466711_029879 | 3300042615 | Bacteria | 23647 |
| 115 | Ga0466711_112325 | 3300042615 | Bacteria | 6100 |
| 116 | Ga0466715_032768 | 3300042616 | Bacteria | 6978 |
| 117 | Ga0123356_10002494 | 3300010049 | Bacteria | 19658 |
| 118 | JGI24698J34947_10012329 | 3300002449 | Bacteria | 4685 |
| 119 | JGI24695J34938_10001086 | 3300002450 | Bacteria | 24572 |
| 120 | JGI24695J34938_10002855 | 3300002450 | Bacteria | 12589 |
| 121 | JGI24695J34938_10003706 | 3300002450 | Bacteria | 10443 |
| 122 | JGI24699J35502_11116428 | 3300002509 | Unclassified | 2968 |
| 123 | Ga0264413_113904 | 3300024493 | Bacteria | 25260 |
| 124 | Ga0466690_156939 | 3300042590 | Bacteria | 13767 |
| 125 | Ga0466719_126939 | 3300042606 | Bacteria | 2514 |
| 126 | Ga0466702_124742 | 3300042635 | Bacteria | 24190 |
| 127 | Ga0466703_164953 | 3300042636 | Bacteria | 4699 |
| 128 | Ga0466704_234900 | 3300042643 | Bacteria | 9668 |
| 129 | Ga0466704_306659 | 3300042643 | Bacteria | 4563 |
| 130 | Ga0466727_063480 | 3300042655 | Bacteria | 8765 |
| 131 | Ga0466712_019884 | 3300042614 | Bacteria | 29756 |
| 132 | Ga0466712_117129 | 3300042614 | Bacteria | 17790 |
| 133 | Ga0466712_187575 | 3300042614 | Bacteria | 8280 |
| 134 | Ga0466711_316426 | 3300042615 | Bacteria | 7618 |
| 135 | Ga0466711_410963 | 3300042615 | Bacteria | 19657 |
| 136 | Ga0466718_067794 | 3300042617 | Unclassified | 5353 |
| 137 | Ga0123356_10001079 | 3300010049 | Bacteria | 30219 |
| 138 | Ga0123356_10015219 | 3300010049 | Bacteria | 7375 |
| 139 | Ga0123356_10086248 | 3300010049 | Bacteria | 2980 |
| 140 | Ga0123353_10253700 | 3300010167 | Bacteria | 2722 |
| 141 | JGI24698J34947_10003778 | 3300002449 | Bacteria | 8253 |
| 142 | JGI24698J34947_10011578 | 3300002449 | Bacteria | 4842 |
| 143 | JGI24698J34947_10015440 | 3300002449 | Bacteria | 4157 |
| 144 | JGI24695J34938_10000125 | 3300002450 | Bacteria | 68505 |
| 145 | JGI24695J34938_10001389 | 3300002450 | Bacteria | 20717 |
| 146 | JGI24695J34938_10008278 | 3300002450 | Bacteria | 5944 |
| 147 | Ga0123357_10000428 | 3300009784 | Bacteria | 40312 |
| 148 | Ga0264413_102510 | 3300024493 | Bacteria | 10884 |
| 149 | Ga0415639_015514 | 3300038395 | Bacteria | 1781 |
| 150 | Ga0415639_035285 | 3300038395 | Bacteria | 4636 |
| 151 | Ga0466690_022964 | 3300042590 | Bacteria | 5565 |
| 152 | Ga0466693_028718 | 3300042592 | Bacteria | 33667 |
| 153 | Ga0466693_445889 | 3300042592 | Bacteria | 25520 |
| 154 | Ga0466716_006790 | 3300042605 | Bacteria | 2868 |
| 155 | Ga0466716_146375 | 3300042605 | Bacteria | 9861 |
| 156 | Ga0466722_136947 | 3300042609 | Bacteria | 3880 |
| 157 | Ga0466702_166587 | 3300042635 | Bacteria | 15230 |
| 158 | Ga0466704_169020 | 3300042643 | Bacteria | 9946 |
| 159 | Ga0466732_184891 | 3300042656 | Bacteria | 23606 |
| 160 | Ga0466705_466589 | 3300042612 | Bacteria | 7319 |
| 161 | Ga0466712_042474 | 3300042614 | Bacteria | 3654 |
| 162 | Ga0466712_060478 | 3300042614 | Bacteria | 21849 |
| 163 | Ga0466712_089435 | 3300042614 | Bacteria | 21004 |
| 164 | Ga0466712_294130 | 3300042614 | Bacteria | 17165 |
| 165 | Ga0466715_063253 | 3300042616 | Bacteria | 29345 |
| 166 | Ga0466718_067704 | 3300042617 | Bacteria | 6305 |
| 167 | Ga0466723_211311 | 3300042618 | Bacteria | 3044 |
| 168 | Ga0123356_10000640 | 3300010049 | Bacteria | 38584 |
| 169 | Ga0123356_10014722 | 3300010049 | Bacteria | 7515 |
| 170 | Ga0123356_10018224 | 3300010049 | Bacteria | 6667 |
| 171 | Ga0123356_10023856 | 3300010049 | Bacteria | 5756 |
| 172 | Ga0123353_10142564 | 3300010167 | Bacteria | 3836 |
| 173 | JGI24698J34947_10001734 | 3300002449 | Bacteria | 11628 |
| 174 | JGI24698J34947_10002943 | 3300002449 | Bacteria | 9238 |
| 175 | JGI24698J34947_10022841 | 3300002449 | Bacteria | 3350 |
| 176 | JGI24695J34938_10000769 | 3300002450 | Bacteria | 29994 |
| 177 | JGI24695J34938_10013100 | 3300002450 | Bacteria | 4366 |
| 178 | JGI24695J34938_10023079 | 3300002450 | Unclassified | 3006 |
| 179 | JGI24702J35022_10005315 | 3300002462 | Unclassified | 7547 |
| 180 | Ga0456237_0005394 | 3300041968 | Unclassified | 2027 |
| 181 | Ga0466690_319410 | 3300042590 | Bacteria | 6772 |
| 182 | Ga0466692_136612 | 3300042591 | Bacteria | 7984 |
| 183 | Ga0466692_175103 | 3300042591 | Bacteria | 4123 |
| 184 | Ga0466692_191986 | 3300042591 | Bacteria | 42335 |
| 185 | Ga0466693_366331 | 3300042592 | Unclassified | 7697 |
| 186 | Ga0466695_188911 | 3300042595 | Bacteria | 64865 |
| 187 | Ga0466706_226141 | 3300042599 | Bacteria | 10090 |
| 188 | Ga0466714_141934 | 3300042603 | Bacteria | 2001 |
| 189 | Ga0466722_004590 | 3300042609 | Bacteria | 11989 |
| 190 | Ga0466702_019840 | 3300042635 | Bacteria | 15265 |
| 191 | Ga0466708_041197 | 3300042652 | Bacteria | 6339 |
| 192 | Ga0466708_046421 | 3300042652 | Bacteria | 23115 |
| 193 | Ga0466708_363403 | 3300042652 | Bacteria | 10234 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.