Protein Family IF00473
Metagenome
Isolate
248
Members
75
Samples
222
Scaffolds
435
Avg Length
Representative Sequence
- ID
- 3300002449|JGI24698J34947_10001032|JGI24698J34947_100010323
- Length
- 479 aa
- Sequence
- VPLCEIFLISLCLRAPVRDLLNFFVPPCPIADKGEVNYCVCMENKNIAERTRRTEWFRHERFGMFIHWGLYSIPARGEWVRSVERIPHEDYLEYLNEFSAKEYNPREWARLAKKAGMKYAVLTAKHHDGFCLWDTRLTDFKATNTPAGRDLVREYLEAFRDEGLRVGLYFSIIDWRHPDFPHFGDRQHPMRDRAEYGNENRDFRRYLDFMRGQVRELLTDYGRLDIMWFDFSYADMSGTKWKAQELIDMVXXLQPHIITDNRLEGSGEHSGTXLXANPSDYAGDFACPEQMIPPKGIVNEEGKAVPWEACVTLNNHWGYCAGDKHWKSAKMVIRMLAECVSKNGNLLLNVGPDAKGRIPPASIKILEEVGRWMADNGESVYGCGISGYEKPEWGRYTQNGKKLYAHVLEEAVGGICLQGLAGKVEKMRLLSDGSEIKSAQYWNLSEYPKDAFFFLNPSSSDNYPLPDPMDTVVEITLK*
Sample Types
Isolate
10.1%
Metagenome
89.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
34.7%
Unclassified
25.0%
Kalotermitidae
19.4%
Blattidae
5.6%
Rhinotermitidae
4.2%
Termopsidae
4.2%
Passalidae
2.8%
Stratiomyidae
1.4%
Armadillidiidae
1.4%
Pyrrhocoridae
1.4%
Taxonomy
Archaea
0
Bacteria
236
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940221333 | Paenibacillus sp. PastF-3 | Isolate | Blattidae |
| 2 | 2940425923 | Paenibacillus sp. PastH-4 | Isolate | Blattidae |
| 3 | 2820391468 | Unclassified Firmicutes Nc150P3bin1 | Isolate | Unclassified |
| 4 | 2820596822 | Unclassified Firmicutes Emb289P1bin58 | Isolate | Unclassified |
| 5 | 8030343600 | Proteiniborus sp. MB09-C3 | Isolate | Stratiomyidae |
| 6 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 7 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 8 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 9 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 10 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 11 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 12 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 13 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 14 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 15 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 16 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 17 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 18 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 19 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 20 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 21 | 2940413413 | Paenibacillus sp. PastH-3 | Isolate | Blattidae |
| 22 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 23 | 2820513949 | Unclassified Firmicutes Lab288P1bin39 | Isolate | Unclassified |
| 24 | 2820573558 | Unclassified Firmicutes Emb289P3bin140 | Isolate | Unclassified |
| 25 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 26 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 27 | 2820444930 | Unclassified Firmicutes Lab288P3bin199 | Isolate | Unclassified |
| 28 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 29 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 30 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 31 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 32 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 33 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 34 | 2940419646 | Paenibacillus sp. PastF-4 | Isolate | Blattidae |
| 35 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 36 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 37 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 38 | 2820405014 | Unclassified Firmicutes Lab288P4bin88 | Isolate | Unclassified |
| 39 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 40 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 41 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 42 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 43 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 44 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 45 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 46 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 47 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 48 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 49 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 50 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 51 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 52 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 53 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 54 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 55 | 2503538010 | Coriobacterium glomerans PW2, DSM 20642 | Isolate | Pyrrhocoridae |
| 56 | 2576861701 | Paenibacillus sp. JCM 10914 | Isolate | Termitidae |
| 57 | 2820408893 | Unclassified Firmicutes Lab288P4bin80 | Isolate | Unclassified |
| 58 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 59 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 60 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 61 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 62 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 63 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 64 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 65 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 66 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 67 | 2820441105 | Unclassified Firmicutes Lab288P3bin202 | Isolate | Unclassified |
| 68 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 69 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 70 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 71 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 72 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 73 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 74 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 75 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_041977 | 3300042612 | Unclassified | 2478 |
| 2 | Ga0466705_308068 | 3300042612 | Bacteria | 3481 |
| 3 | Ga0466705_531477 | 3300042612 | Bacteria | 2034 |
| 4 | Ga0466712_020206 | 3300042614 | Bacteria | 3372 |
| 5 | Ga0466726_371346 | 3300042619 | Bacteria | 2259 |
| 6 | Ga0466728_437096 | 3300042620 | Bacteria | 9137 |
| 7 | Ga0123357_10299113 | 3300009784 | Bacteria | 1629 |
| 8 | Ga0123355_10204069 | 3300009826 | Bacteria | 2880 |
| 9 | Ga0123356_10071330 | 3300010049 | Bacteria | 3261 |
| 10 | Ga0123353_10008746 | 3300010167 | Bacteria | 13871 |
| 11 | Ga0123353_10160777 | 3300010167 | Bacteria | 3576 |
| 12 | Ga0123353_10487588 | 3300010167 | Bacteria | 1801 |
| 13 | Ga0466692_000697 | 3300042591 | Bacteria | 3833 |
| 14 | Ga0466692_026254 | 3300042591 | Bacteria | 97091 |
| 15 | Ga0466692_169617 | 3300042591 | Bacteria | 1844 |
| 16 | Ga0466693_284844 | 3300042592 | Bacteria | 28082 |
| 17 | Ga0466691_092332 | 3300042593 | Bacteria | 3010 |
| 18 | Ga0466696_172567 | 3300042596 | Bacteria | 4499 |
| 19 | Ga0466699_297353 | 3300042597 | Bacteria | 7219 |
| 20 | Ga0466699_386661 | 3300042597 | Bacteria | 7957 |
| 21 | Ga0466735_169279 | 3300042624 | Bacteria | 5276 |
| 22 | Ga0466703_334262 | 3300042636 | Bacteria | 2374 |
| 23 | Ga0466704_120408 | 3300042643 | Bacteria | 3402 |
| 24 | Ga0466708_086878 | 3300042652 | Bacteria | 11858 |
| 25 | Ga0466708_215177 | 3300042652 | Bacteria | 3039 |
| 26 | Ga0466708_217324 | 3300042652 | Bacteria | 10703 |
| 27 | Ga0466727_299442 | 3300042655 | Bacteria | 1998 |
| 28 | Ga0466716_260135 | 3300042605 | Bacteria | 5463 |
| 29 | Ga0466722_095888 | 3300042609 | Unclassified | 1654 |
| 30 | Ga0466722_194787 | 3300042609 | Bacteria | 1756 |
| 31 | Ga0466722_208341 | 3300042609 | Bacteria | 2469 |
| 32 | 2227480180 | 2225789004 | Bacteria | 81364 |
| 33 | 2227541294 | 2225789004 | Bacteria | 15684 |
| 34 | IMNBL1DRAFT_c0000201 | 3300000062 | Bacteria | 52500 |
| 35 | JGI24695J34938_10001313 | 3300002450 | Bacteria | 21661 |
| 36 | JGI24695J34938_10023241 | 3300002450 | Bacteria | 2992 |
| 37 | Ga0072941_1129619 | 3300005201 | Bacteria | 1634 |
| 38 | Ga0466705_247476 | 3300042612 | Bacteria | 4857 |
| 39 | Ga0466711_233118 | 3300042615 | Bacteria | 21271 |
| 40 | Ga0466723_339104 | 3300042618 | Bacteria | 9353 |
| 41 | Ga0123355_10033487 | 3300009826 | Bacteria | 8347 |
| 42 | Ga0123355_10305280 | 3300009826 | Bacteria | 2164 |
| 43 | Ga0123356_10002475 | 3300010049 | Bacteria | 19721 |
| 44 | Ga0123356_10072613 | 3300010049 | Bacteria | 3233 |
| 45 | Ga0123356_10321022 | 3300010049 | Bacteria | 1662 |
| 46 | Ga0123353_10107699 | 3300010167 | Bacteria | 4491 |
| 47 | Ga0123353_10161321 | 3300010167 | Bacteria | 3569 |
| 48 | Ga0415639_010315 | 3300038395 | Bacteria | 9749 |
| 49 | Ga0415639_079044 | 3300038395 | Bacteria | 6250 |
| 50 | Ga0466699_247800 | 3300042597 | Bacteria | 57069 |
| 51 | Ga0466735_213108 | 3300042624 | Bacteria | 6511 |
| 52 | Ga0466708_280164 | 3300042652 | Bacteria | 4623 |
| 53 | Ga0466700_348267 | 3300042600 | Bacteria | 2482 |
| 54 | Ga0466720_046588 | 3300042607 | Bacteria | 4982 |
| 55 | AustNasuHG_c1002038 | 3300000089 | Unclassified | 7287 |
| 56 | JGI24698J34947_10009842 | 3300002449 | Bacteria | 5243 |
| 57 | JGI24695J34938_10019859 | 3300002450 | Bacteria | 3317 |
| 58 | JGI24702J35022_10002254 | 3300002462 | Bacteria | 11841 |
| 59 | Ga0068305_10086016 | 3300005083 | Bacteria | 3786 |
| 60 | Ga0466712_011784 | 3300042614 | Bacteria | 50228 |
| 61 | Ga0466712_013118 | 3300042614 | Bacteria | 3759 |
| 62 | Ga0466712_024264 | 3300042614 | Unclassified | 10844 |
| 63 | Ga0466723_092855 | 3300042618 | Bacteria | 9556 |
| 64 | Ga0466723_104382 | 3300042618 | Bacteria | 6512 |
| 65 | Ga0466723_174519 | 3300042618 | Bacteria | 6251 |
| 66 | Ga0466723_178876 | 3300042618 | Bacteria | 3177 |
| 67 | Ga0466723_186913 | 3300042618 | Bacteria | 20219 |
| 68 | Ga0123355_10000302 | 3300009826 | Bacteria | 63226 |
| 69 | Ga0123356_10028252 | 3300010049 | Bacteria | 5255 |
| 70 | Ga0123356_10208224 | 3300010049 | Bacteria | 2001 |
| 71 | Ga0123353_10113799 | 3300010167 | Bacteria | 4356 |
| 72 | Ga0123353_10196322 | 3300010167 | Bacteria | 3181 |
| 73 | Ga0466690_060269 | 3300042590 | Unclassified | 4378 |
| 74 | Ga0466690_182116 | 3300042590 | Unclassified | 2451 |
| 75 | Ga0466692_191203 | 3300042591 | Bacteria | 5858 |
| 76 | Ga0466693_324758 | 3300042592 | Bacteria | 2740 |
| 77 | Ga0466704_095840 | 3300042643 | Bacteria | 7036 |
| 78 | Ga0466704_239917 | 3300042643 | Bacteria | 52442 |
| 79 | Ga0466709_026197 | 3300042648 | Bacteria | 1827 |
| 80 | Ga0466708_020303 | 3300042652 | Bacteria | 5814 |
| 81 | Ga0466708_273900 | 3300042652 | Bacteria | 4003 |
| 82 | Ga0466722_024956 | 3300042609 | Bacteria | 18152 |
| 83 | 2227599634 | 2225789004 | Unclassified | 12537 |
| 84 | Ga0123357_10000794 | 3300009784 | Bacteria | 31948 |
| 85 | Ga0466705_195033 | 3300042612 | Bacteria | 13665 |
| 86 | Ga0466712_036251 | 3300042614 | Bacteria | 44742 |
| 87 | Ga0466715_008702 | 3300042616 | Bacteria | 7784 |
| 88 | Ga0466718_063482 | 3300042617 | Bacteria | 5200 |
| 89 | Ga0466726_140010 | 3300042619 | Bacteria | 5204 |
| 90 | Ga0466728_101622 | 3300042620 | Bacteria | 11386 |
| 91 | Ga0123355_10160210 | 3300009826 | Bacteria | 3392 |
| 92 | Ga0123356_10000930 | 3300010049 | Bacteria | 32341 |
| 93 | Ga0123354_10026408 | 3300010882 | Bacteria | 9158 |
| 94 | Ga0123354_10233707 | 3300010882 | Bacteria | 1914 |
| 95 | Ga0160466_100145 | 3300012809 | Bacteria | 56899 |
| 96 | Ga0466692_204240 | 3300042591 | Bacteria | 36789 |
| 97 | Ga0466691_207515 | 3300042593 | Bacteria | 10069 |
| 98 | Ga0466696_151382 | 3300042596 | Bacteria | 5950 |
| 99 | Ga0466696_331190 | 3300042596 | Bacteria | 65152 |
| 100 | Ga0466699_218308 | 3300042597 | Bacteria | 1900 |
| 101 | Ga0466703_167259 | 3300042636 | Bacteria | 13825 |
| 102 | Ga0466727_007287 | 3300042655 | Bacteria | 2578 |
| 103 | Ga0466716_044030 | 3300042605 | Bacteria | 5646 |
| 104 | Ga0466716_303590 | 3300042605 | Bacteria | 11137 |
| 105 | Ga0466722_013545 | 3300042609 | Bacteria | 5360 |
| 106 | IMNBL1DRAFT_c0000073 | 3300000062 | Bacteria | 90912 |
| 107 | JGI24698J34947_10001032 | 3300002449 | Bacteria | 14340 |
| 108 | JGI24695J34938_10021021 | 3300002450 | Bacteria | 3201 |
| 109 | Ga0466705_202842 | 3300042612 | Bacteria | 1536 |
| 110 | Ga0466712_138415 | 3300042614 | Bacteria | 2720 |
| 111 | Ga0466711_187177 | 3300042615 | Bacteria | 2903 |
| 112 | Ga0466711_235049 | 3300042615 | Bacteria | 4738 |
| 113 | Ga0466723_207707 | 3300042618 | Bacteria | 18495 |
| 114 | Ga0123355_10001213 | 3300009826 | Bacteria | 35882 |
| 115 | Ga0123355_10006076 | 3300009826 | Bacteria | 17804 |
| 116 | Ga0123356_10004244 | 3300010049 | Bacteria | 14833 |
| 117 | Ga0123356_10014676 | 3300010049 | Bacteria | 7528 |
| 118 | Ga0123353_10015635 | 3300010167 | Bacteria | 11039 |
| 119 | Ga0123353_10048417 | 3300010167 | Bacteria | 6768 |
| 120 | Ga0160445_100975 | 3300012847 | Bacteria | 9660 |
| 121 | Ga0415639_108375 | 3300038395 | Bacteria | 2856 |
| 122 | Ga0415639_174971 | 3300038395 | Bacteria | 4829 |
| 123 | Ga0466692_190941 | 3300042591 | Bacteria | 24770 |
| 124 | Ga0466704_291799 | 3300042643 | Bacteria | 4500 |
| 125 | Ga0466704_334141 | 3300042643 | Bacteria | 4685 |
| 126 | Ga0466704_435552 | 3300042643 | Bacteria | 4889 |
| 127 | Ga0466701_039531 | 3300042598 | Bacteria | 1563 |
| 128 | Ga0466719_210938 | 3300042606 | Bacteria | 10114 |
| 129 | Ga0466719_458870 | 3300042606 | Bacteria | 9954 |
| 130 | JGI24696J40584_12956665 | 3300002834 | Bacteria | 3187 |
| 131 | Ga0466733_056163 | 3300042659 | Bacteria | 2032 |
| 132 | Ga0466718_123298 | 3300042617 | Bacteria | 2152 |
| 133 | Ga0466723_218636 | 3300042618 | Bacteria | 16915 |
| 134 | Ga0466729_130065 | 3300042621 | Bacteria | 1699 |
| 135 | Ga0123355_10029962 | 3300009826 | Bacteria | 8817 |
| 136 | Ga0123356_10013497 | 3300010049 | Bacteria | 7881 |
| 137 | Ga0123353_10081234 | 3300010167 | Bacteria | 5212 |
| 138 | Ga0123353_10103970 | 3300010167 | Bacteria | 4578 |
| 139 | Ga0466690_142488 | 3300042590 | Bacteria | 2722 |
| 140 | Ga0466691_125799 | 3300042593 | Bacteria | 12226 |
| 141 | Ga0466691_138250 | 3300042593 | Bacteria | 8848 |
| 142 | Ga0466696_496605 | 3300042596 | Bacteria | 12357 |
| 143 | Ga0466699_307767 | 3300042597 | Bacteria | 41126 |
| 144 | Ga0466699_323768 | 3300042597 | Bacteria | 7106 |
| 145 | Ga0466699_428989 | 3300042597 | Bacteria | 7337 |
| 146 | Ga0466735_114991 | 3300042624 | Bacteria | 2274 |
| 147 | Ga0466703_322246 | 3300042636 | Bacteria | 12524 |
| 148 | Ga0466709_328099 | 3300042648 | Bacteria | 25608 |
| 149 | Ga0466708_124180 | 3300042652 | Bacteria | 8199 |
| 150 | Ga0466700_192092 | 3300042600 | Bacteria | 2027 |
| 151 | Ga0466707_249717 | 3300042601 | Bacteria | 2393 |
| 152 | Ga0466714_018162 | 3300042603 | Bacteria | 4493 |
| 153 | Ga0466719_169482 | 3300042606 | Bacteria | 2625 |
| 154 | Ga0466720_066630 | 3300042607 | Bacteria | 19303 |
| 155 | Ga0466720_111320 | 3300042607 | Bacteria | 1664 |
| 156 | Ga0466722_193064 | 3300042609 | Bacteria | 3964 |
| 157 | JGI24695J34938_10000142 | 3300002450 | Bacteria | 65463 |
| 158 | JGI24695J34938_10000374 | 3300002450 | Bacteria | 44420 |
| 159 | JGI24695J34938_10003030 | 3300002450 | Bacteria | 12060 |
| 160 | JGI24695J34938_10003774 | 3300002450 | Bacteria | 10327 |
| 161 | JGI24695J34938_10054310 | 3300002450 | Bacteria | 1738 |
| 162 | Ga0466705_193085 | 3300042612 | Bacteria | 6463 |
| 163 | Ga0466732_305072 | 3300042656 | Bacteria | 3683 |
| 164 | Ga0466712_316749 | 3300042614 | Bacteria | 2281 |
| 165 | Ga0466711_374989 | 3300042615 | Bacteria | 87344 |
| 166 | Ga0466715_429009 | 3300042616 | Bacteria | 4283 |
| 167 | Ga0466726_225712 | 3300042619 | Bacteria | 1908 |
| 168 | Ga0466728_114330 | 3300042620 | Bacteria | 8760 |
| 169 | Ga0466728_288832 | 3300042620 | Bacteria | 7047 |
| 170 | Ga0466728_311164 | 3300042620 | Bacteria | 6200 |
| 171 | Ga0123355_10000681 | 3300009826 | Bacteria | 46239 |
| 172 | Ga0123355_10183013 | 3300009826 | Bacteria | 3106 |
| 173 | Ga0123356_10030352 | 3300010049 | Bacteria | 5060 |
| 174 | Ga0123356_10090793 | 3300010049 | Bacteria | 2910 |
| 175 | Ga0123356_10159918 | 3300010049 | Bacteria | 2248 |
| 176 | Ga0123356_10279707 | 3300010049 | Bacteria | 1763 |
| 177 | Ga0123353_10001073 | 3300010167 | Bacteria | 33352 |
| 178 | Ga0123354_10166943 | 3300010882 | Bacteria | 2583 |
| 179 | Ga0160454_100025 | 3300012798 | Bacteria | 286348 |
| 180 | Ga0466691_026131 | 3300042593 | Bacteria | 20728 |
| 181 | Ga0466696_005818 | 3300042596 | Bacteria | 27640 |
| 182 | Ga0466696_156495 | 3300042596 | Bacteria | 22077 |
| 183 | Ga0466699_110498 | 3300042597 | Bacteria | 24920 |
| 184 | Ga0466701_001859 | 3300042598 | Bacteria | 32030 |
| 185 | Ga0466716_132454 | 3300042605 | Bacteria | 2716 |
| 186 | Ga0466719_375926 | 3300042606 | Bacteria | 4916 |
| 187 | Ga0466722_184004 | 3300042609 | Bacteria | 3583 |
| 188 | IMNBL1DRAFT_c0031178 | 3300000062 | Bacteria | 1943 |
| 189 | JGI24698J34947_10043072 | 3300002449 | Bacteria | 2315 |
| 190 | JGI24695J34938_10003277 | 3300002450 | Bacteria | 11420 |
| 191 | JGI24695J34938_10024190 | 3300002450 | Unclassified | 2919 |
| 192 | JGI24703J35330_11743335 | 3300002501 | Bacteria | 3880 |
| 193 | Ga0466705_169194 | 3300042612 | Bacteria | 3341 |
| 194 | Ga0466715_607828 | 3300042616 | Bacteria | 77672 |
| 195 | Ga0466723_158107 | 3300042618 | Bacteria | 2467 |
| 196 | Ga0123355_10032114 | 3300009826 | Bacteria | 8521 |
| 197 | Ga0123355_10050206 | 3300009826 | Bacteria | 6779 |
| 198 | Ga0123353_10022005 | 3300010167 | Bacteria | 9592 |
| 199 | Ga0123353_10056029 | 3300010167 | Unclassified | 6308 |
| 200 | Ga0123353_10074326 | 3300010167 | Bacteria | 5463 |
| 201 | Ga0123354_10089532 | 3300010882 | Bacteria | 4270 |
| 202 | Ga0466690_161537 | 3300042590 | Bacteria | 1855 |
| 203 | Ga0466694_049644 | 3300042594 | Bacteria | 2382 |
| 204 | Ga0466696_151665 | 3300042596 | Unclassified | 4449 |
| 205 | Ga0466703_026580 | 3300042636 | Bacteria | 2840 |
| 206 | Ga0466703_251037 | 3300042636 | Bacteria | 17596 |
| 207 | Ga0466704_090139 | 3300042643 | Bacteria | 5730 |
| 208 | Ga0466709_225581 | 3300042648 | Bacteria | 3003 |
| 209 | Ga0466709_301322 | 3300042648 | Bacteria | 2309 |
| 210 | Ga0466708_198549 | 3300042652 | Bacteria | 2180 |
| 211 | Ga0466701_051329 | 3300042598 | Bacteria | 2617 |
| 212 | Ga0466714_010591 | 3300042603 | Bacteria | 39899 |
| 213 | Ga0466714_016738 | 3300042603 | Bacteria | 3906 |
| 214 | Ga0466714_108124 | 3300042603 | Bacteria | 1731 |
| 215 | Ga0466714_115033 | 3300042603 | Bacteria | 15114 |
| 216 | Ga0466716_119478 | 3300042605 | Bacteria | 1475 |
| 217 | IMNBL1DRAFT_c0007090 | 3300000062 | Unclassified | 5964 |
| 218 | JGI24698J34947_10001707 | 3300002449 | Bacteria | 11711 |
| 219 | JGI24698J34947_10024380 | 3300002449 | Unclassified | 3230 |
| 220 | JGI24695J34938_10000003 | 3300002450 | Bacteria | 167365 |
| 221 | JGI24695J34938_10001703 | 3300002450 | Bacteria | 18182 |
| 222 | JGI24695J34938_10010370 | 3300002450 | Bacteria | 5105 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.