Protein Family IF00473

Metagenome Isolate
248 Members
75 Samples
222 Scaffolds
435 Avg Length

🧬 Representative Sequence

ID
3300002449|JGI24698J34947_10001032|JGI24698J34947_100010323
Length
479 aa
Sequence
VPLCEIFLISLCLRAPVRDLLNFFVPPCPIADKGEVNYCVCMENKNIAERTRRTEWFRHERFGMFIHWGLYSIPARGEWVRSVERIPHEDYLEYLNEFSAKEYNPREWARLAKKAGMKYAVLTAKHHDGFCLWDTRLTDFKATNTPAGRDLVREYLEAFRDEGLRVGLYFSIIDWRHPDFPHFGDRQHPMRDRAEYGNENRDFRRYLDFMRGQVRELLTDYGRLDIMWFDFSYADMSGTKWKAQELIDMVXXLQPHIITDNRLEGSGEHSGTXLXANPSDYAGDFACPEQMIPPKGIVNEEGKAVPWEACVTLNNHWGYCAGDKHWKSAKMVIRMLAECVSKNGNLLLNVGPDAKGRIPPASIKILEEVGRWMADNGESVYGCGISGYEKPEWGRYTQNGKKLYAHVLEEAVGGICLQGLAGKVEKMRLLSDGSEIKSAQYWNLSEYPKDAFFFLNPSSSDNYPLPDPMDTVVEITLK*

πŸ“Š Sample Types

Isolate 10.1%
Metagenome 89.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 34.7%
Unclassified 25.0%
Kalotermitidae 19.4%
Blattidae 5.6%
Rhinotermitidae 4.2%
Termopsidae 4.2%
Passalidae 2.8%
Stratiomyidae 1.4%
Armadillidiidae 1.4%
Pyrrhocoridae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 236
Eukaryota 0
Viruses 0
Unclassified 12

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940221333 Paenibacillus sp. PastF-3 Isolate Blattidae
2 2940425923 Paenibacillus sp. PastH-4 Isolate Blattidae
3 2820391468 Unclassified Firmicutes Nc150P3bin1 Isolate Unclassified
4 2820596822 Unclassified Firmicutes Emb289P1bin58 Isolate Unclassified
5 8030343600 Proteiniborus sp. MB09-C3 Isolate Stratiomyidae
6 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
7 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
8 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
9 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
10 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
11 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
12 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
13 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
14 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
15 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
16 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
17 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
18 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
19 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
20 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
21 2940413413 Paenibacillus sp. PastH-3 Isolate Blattidae
22 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
23 2820513949 Unclassified Firmicutes Lab288P1bin39 Isolate Unclassified
24 2820573558 Unclassified Firmicutes Emb289P3bin140 Isolate Unclassified
25 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
26 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
27 2820444930 Unclassified Firmicutes Lab288P3bin199 Isolate Unclassified
28 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
29 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
30 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
31 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
32 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
33 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
34 2940419646 Paenibacillus sp. PastF-4 Isolate Blattidae
35 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
36 2781125683 Treponema sp. Lab288P1bin34 Isolate Unclassified
37 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
38 2820405014 Unclassified Firmicutes Lab288P4bin88 Isolate Unclassified
39 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
40 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
41 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
42 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
43 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
44 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
45 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
46 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
47 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
48 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
49 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
50 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
51 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
52 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
53 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
54 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
55 2503538010 Coriobacterium glomerans PW2, DSM 20642 Isolate Pyrrhocoridae
56 2576861701 Paenibacillus sp. JCM 10914 Isolate Termitidae
57 2820408893 Unclassified Firmicutes Lab288P4bin80 Isolate Unclassified
58 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
59 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
60 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
61 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
62 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
63 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
64 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
65 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
66 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
67 2820441105 Unclassified Firmicutes Lab288P3bin202 Isolate Unclassified
68 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
69 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
70 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
71 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
72 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
73 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
74 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
75 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_041977 3300042612 Unclassified 2478
2 Ga0466705_308068 3300042612 Bacteria 3481
3 Ga0466705_531477 3300042612 Bacteria 2034
4 Ga0466712_020206 3300042614 Bacteria 3372
5 Ga0466726_371346 3300042619 Bacteria 2259
6 Ga0466728_437096 3300042620 Bacteria 9137
7 Ga0123357_10299113 3300009784 Bacteria 1629
8 Ga0123355_10204069 3300009826 Bacteria 2880
9 Ga0123356_10071330 3300010049 Bacteria 3261
10 Ga0123353_10008746 3300010167 Bacteria 13871
11 Ga0123353_10160777 3300010167 Bacteria 3576
12 Ga0123353_10487588 3300010167 Bacteria 1801
13 Ga0466692_000697 3300042591 Bacteria 3833
14 Ga0466692_026254 3300042591 Bacteria 97091
15 Ga0466692_169617 3300042591 Bacteria 1844
16 Ga0466693_284844 3300042592 Bacteria 28082
17 Ga0466691_092332 3300042593 Bacteria 3010
18 Ga0466696_172567 3300042596 Bacteria 4499
19 Ga0466699_297353 3300042597 Bacteria 7219
20 Ga0466699_386661 3300042597 Bacteria 7957
21 Ga0466735_169279 3300042624 Bacteria 5276
22 Ga0466703_334262 3300042636 Bacteria 2374
23 Ga0466704_120408 3300042643 Bacteria 3402
24 Ga0466708_086878 3300042652 Bacteria 11858
25 Ga0466708_215177 3300042652 Bacteria 3039
26 Ga0466708_217324 3300042652 Bacteria 10703
27 Ga0466727_299442 3300042655 Bacteria 1998
28 Ga0466716_260135 3300042605 Bacteria 5463
29 Ga0466722_095888 3300042609 Unclassified 1654
30 Ga0466722_194787 3300042609 Bacteria 1756
31 Ga0466722_208341 3300042609 Bacteria 2469
32 2227480180 2225789004 Bacteria 81364
33 2227541294 2225789004 Bacteria 15684
34 IMNBL1DRAFT_c0000201 3300000062 Bacteria 52500
35 JGI24695J34938_10001313 3300002450 Bacteria 21661
36 JGI24695J34938_10023241 3300002450 Bacteria 2992
37 Ga0072941_1129619 3300005201 Bacteria 1634
38 Ga0466705_247476 3300042612 Bacteria 4857
39 Ga0466711_233118 3300042615 Bacteria 21271
40 Ga0466723_339104 3300042618 Bacteria 9353
41 Ga0123355_10033487 3300009826 Bacteria 8347
42 Ga0123355_10305280 3300009826 Bacteria 2164
43 Ga0123356_10002475 3300010049 Bacteria 19721
44 Ga0123356_10072613 3300010049 Bacteria 3233
45 Ga0123356_10321022 3300010049 Bacteria 1662
46 Ga0123353_10107699 3300010167 Bacteria 4491
47 Ga0123353_10161321 3300010167 Bacteria 3569
48 Ga0415639_010315 3300038395 Bacteria 9749
49 Ga0415639_079044 3300038395 Bacteria 6250
50 Ga0466699_247800 3300042597 Bacteria 57069
51 Ga0466735_213108 3300042624 Bacteria 6511
52 Ga0466708_280164 3300042652 Bacteria 4623
53 Ga0466700_348267 3300042600 Bacteria 2482
54 Ga0466720_046588 3300042607 Bacteria 4982
55 AustNasuHG_c1002038 3300000089 Unclassified 7287
56 JGI24698J34947_10009842 3300002449 Bacteria 5243
57 JGI24695J34938_10019859 3300002450 Bacteria 3317
58 JGI24702J35022_10002254 3300002462 Bacteria 11841
59 Ga0068305_10086016 3300005083 Bacteria 3786
60 Ga0466712_011784 3300042614 Bacteria 50228
61 Ga0466712_013118 3300042614 Bacteria 3759
62 Ga0466712_024264 3300042614 Unclassified 10844
63 Ga0466723_092855 3300042618 Bacteria 9556
64 Ga0466723_104382 3300042618 Bacteria 6512
65 Ga0466723_174519 3300042618 Bacteria 6251
66 Ga0466723_178876 3300042618 Bacteria 3177
67 Ga0466723_186913 3300042618 Bacteria 20219
68 Ga0123355_10000302 3300009826 Bacteria 63226
69 Ga0123356_10028252 3300010049 Bacteria 5255
70 Ga0123356_10208224 3300010049 Bacteria 2001
71 Ga0123353_10113799 3300010167 Bacteria 4356
72 Ga0123353_10196322 3300010167 Bacteria 3181
73 Ga0466690_060269 3300042590 Unclassified 4378
74 Ga0466690_182116 3300042590 Unclassified 2451
75 Ga0466692_191203 3300042591 Bacteria 5858
76 Ga0466693_324758 3300042592 Bacteria 2740
77 Ga0466704_095840 3300042643 Bacteria 7036
78 Ga0466704_239917 3300042643 Bacteria 52442
79 Ga0466709_026197 3300042648 Bacteria 1827
80 Ga0466708_020303 3300042652 Bacteria 5814
81 Ga0466708_273900 3300042652 Bacteria 4003
82 Ga0466722_024956 3300042609 Bacteria 18152
83 2227599634 2225789004 Unclassified 12537
84 Ga0123357_10000794 3300009784 Bacteria 31948
85 Ga0466705_195033 3300042612 Bacteria 13665
86 Ga0466712_036251 3300042614 Bacteria 44742
87 Ga0466715_008702 3300042616 Bacteria 7784
88 Ga0466718_063482 3300042617 Bacteria 5200
89 Ga0466726_140010 3300042619 Bacteria 5204
90 Ga0466728_101622 3300042620 Bacteria 11386
91 Ga0123355_10160210 3300009826 Bacteria 3392
92 Ga0123356_10000930 3300010049 Bacteria 32341
93 Ga0123354_10026408 3300010882 Bacteria 9158
94 Ga0123354_10233707 3300010882 Bacteria 1914
95 Ga0160466_100145 3300012809 Bacteria 56899
96 Ga0466692_204240 3300042591 Bacteria 36789
97 Ga0466691_207515 3300042593 Bacteria 10069
98 Ga0466696_151382 3300042596 Bacteria 5950
99 Ga0466696_331190 3300042596 Bacteria 65152
100 Ga0466699_218308 3300042597 Bacteria 1900
101 Ga0466703_167259 3300042636 Bacteria 13825
102 Ga0466727_007287 3300042655 Bacteria 2578
103 Ga0466716_044030 3300042605 Bacteria 5646
104 Ga0466716_303590 3300042605 Bacteria 11137
105 Ga0466722_013545 3300042609 Bacteria 5360
106 IMNBL1DRAFT_c0000073 3300000062 Bacteria 90912
107 JGI24698J34947_10001032 3300002449 Bacteria 14340
108 JGI24695J34938_10021021 3300002450 Bacteria 3201
109 Ga0466705_202842 3300042612 Bacteria 1536
110 Ga0466712_138415 3300042614 Bacteria 2720
111 Ga0466711_187177 3300042615 Bacteria 2903
112 Ga0466711_235049 3300042615 Bacteria 4738
113 Ga0466723_207707 3300042618 Bacteria 18495
114 Ga0123355_10001213 3300009826 Bacteria 35882
115 Ga0123355_10006076 3300009826 Bacteria 17804
116 Ga0123356_10004244 3300010049 Bacteria 14833
117 Ga0123356_10014676 3300010049 Bacteria 7528
118 Ga0123353_10015635 3300010167 Bacteria 11039
119 Ga0123353_10048417 3300010167 Bacteria 6768
120 Ga0160445_100975 3300012847 Bacteria 9660
121 Ga0415639_108375 3300038395 Bacteria 2856
122 Ga0415639_174971 3300038395 Bacteria 4829
123 Ga0466692_190941 3300042591 Bacteria 24770
124 Ga0466704_291799 3300042643 Bacteria 4500
125 Ga0466704_334141 3300042643 Bacteria 4685
126 Ga0466704_435552 3300042643 Bacteria 4889
127 Ga0466701_039531 3300042598 Bacteria 1563
128 Ga0466719_210938 3300042606 Bacteria 10114
129 Ga0466719_458870 3300042606 Bacteria 9954
130 JGI24696J40584_12956665 3300002834 Bacteria 3187
131 Ga0466733_056163 3300042659 Bacteria 2032
132 Ga0466718_123298 3300042617 Bacteria 2152
133 Ga0466723_218636 3300042618 Bacteria 16915
134 Ga0466729_130065 3300042621 Bacteria 1699
135 Ga0123355_10029962 3300009826 Bacteria 8817
136 Ga0123356_10013497 3300010049 Bacteria 7881
137 Ga0123353_10081234 3300010167 Bacteria 5212
138 Ga0123353_10103970 3300010167 Bacteria 4578
139 Ga0466690_142488 3300042590 Bacteria 2722
140 Ga0466691_125799 3300042593 Bacteria 12226
141 Ga0466691_138250 3300042593 Bacteria 8848
142 Ga0466696_496605 3300042596 Bacteria 12357
143 Ga0466699_307767 3300042597 Bacteria 41126
144 Ga0466699_323768 3300042597 Bacteria 7106
145 Ga0466699_428989 3300042597 Bacteria 7337
146 Ga0466735_114991 3300042624 Bacteria 2274
147 Ga0466703_322246 3300042636 Bacteria 12524
148 Ga0466709_328099 3300042648 Bacteria 25608
149 Ga0466708_124180 3300042652 Bacteria 8199
150 Ga0466700_192092 3300042600 Bacteria 2027
151 Ga0466707_249717 3300042601 Bacteria 2393
152 Ga0466714_018162 3300042603 Bacteria 4493
153 Ga0466719_169482 3300042606 Bacteria 2625
154 Ga0466720_066630 3300042607 Bacteria 19303
155 Ga0466720_111320 3300042607 Bacteria 1664
156 Ga0466722_193064 3300042609 Bacteria 3964
157 JGI24695J34938_10000142 3300002450 Bacteria 65463
158 JGI24695J34938_10000374 3300002450 Bacteria 44420
159 JGI24695J34938_10003030 3300002450 Bacteria 12060
160 JGI24695J34938_10003774 3300002450 Bacteria 10327
161 JGI24695J34938_10054310 3300002450 Bacteria 1738
162 Ga0466705_193085 3300042612 Bacteria 6463
163 Ga0466732_305072 3300042656 Bacteria 3683
164 Ga0466712_316749 3300042614 Bacteria 2281
165 Ga0466711_374989 3300042615 Bacteria 87344
166 Ga0466715_429009 3300042616 Bacteria 4283
167 Ga0466726_225712 3300042619 Bacteria 1908
168 Ga0466728_114330 3300042620 Bacteria 8760
169 Ga0466728_288832 3300042620 Bacteria 7047
170 Ga0466728_311164 3300042620 Bacteria 6200
171 Ga0123355_10000681 3300009826 Bacteria 46239
172 Ga0123355_10183013 3300009826 Bacteria 3106
173 Ga0123356_10030352 3300010049 Bacteria 5060
174 Ga0123356_10090793 3300010049 Bacteria 2910
175 Ga0123356_10159918 3300010049 Bacteria 2248
176 Ga0123356_10279707 3300010049 Bacteria 1763
177 Ga0123353_10001073 3300010167 Bacteria 33352
178 Ga0123354_10166943 3300010882 Bacteria 2583
179 Ga0160454_100025 3300012798 Bacteria 286348
180 Ga0466691_026131 3300042593 Bacteria 20728
181 Ga0466696_005818 3300042596 Bacteria 27640
182 Ga0466696_156495 3300042596 Bacteria 22077
183 Ga0466699_110498 3300042597 Bacteria 24920
184 Ga0466701_001859 3300042598 Bacteria 32030
185 Ga0466716_132454 3300042605 Bacteria 2716
186 Ga0466719_375926 3300042606 Bacteria 4916
187 Ga0466722_184004 3300042609 Bacteria 3583
188 IMNBL1DRAFT_c0031178 3300000062 Bacteria 1943
189 JGI24698J34947_10043072 3300002449 Bacteria 2315
190 JGI24695J34938_10003277 3300002450 Bacteria 11420
191 JGI24695J34938_10024190 3300002450 Unclassified 2919
192 JGI24703J35330_11743335 3300002501 Bacteria 3880
193 Ga0466705_169194 3300042612 Bacteria 3341
194 Ga0466715_607828 3300042616 Bacteria 77672
195 Ga0466723_158107 3300042618 Bacteria 2467
196 Ga0123355_10032114 3300009826 Bacteria 8521
197 Ga0123355_10050206 3300009826 Bacteria 6779
198 Ga0123353_10022005 3300010167 Bacteria 9592
199 Ga0123353_10056029 3300010167 Unclassified 6308
200 Ga0123353_10074326 3300010167 Bacteria 5463
201 Ga0123354_10089532 3300010882 Bacteria 4270
202 Ga0466690_161537 3300042590 Bacteria 1855
203 Ga0466694_049644 3300042594 Bacteria 2382
204 Ga0466696_151665 3300042596 Unclassified 4449
205 Ga0466703_026580 3300042636 Bacteria 2840
206 Ga0466703_251037 3300042636 Bacteria 17596
207 Ga0466704_090139 3300042643 Bacteria 5730
208 Ga0466709_225581 3300042648 Bacteria 3003
209 Ga0466709_301322 3300042648 Bacteria 2309
210 Ga0466708_198549 3300042652 Bacteria 2180
211 Ga0466701_051329 3300042598 Bacteria 2617
212 Ga0466714_010591 3300042603 Bacteria 39899
213 Ga0466714_016738 3300042603 Bacteria 3906
214 Ga0466714_108124 3300042603 Bacteria 1731
215 Ga0466714_115033 3300042603 Bacteria 15114
216 Ga0466716_119478 3300042605 Bacteria 1475
217 IMNBL1DRAFT_c0007090 3300000062 Unclassified 5964
218 JGI24698J34947_10001707 3300002449 Bacteria 11711
219 JGI24698J34947_10024380 3300002449 Unclassified 3230
220 JGI24695J34938_10000003 3300002450 Bacteria 167365
221 JGI24695J34938_10001703 3300002450 Bacteria 18182
222 JGI24695J34938_10010370 3300002450 Bacteria 5105

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01120 Alpha_L_fucos Alpha-L-fucosidase 50 378 0.9
PF14871 GHL6 Hypothetical glycosyl hydrolase 6 105 176 0.87

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.