Protein Family IF00298
Metagenome
Isolate
182
Members
51
Samples
177
Scaffolds
236.12
Avg Length
Representative Sequence
- ID
- 3300000089|AustNasuHG_c1029995|AustNasuHG_10299952
- Length
- 283 aa
- Sequence
- LPSLILYAVDAVVEIHCFILSDDNNLVTLAQCLYNNNMLGPIVNAAAILVFSLIGTFLIKGIPDRIEEILKKAVGLSVIYLGIRGTFDNERTLLLVMSMVIGALIGELIDIDKWMNRLGLWAEKKLGMQKDDAPAVHEGTAAKKSKHSFSKAFVSASILFCTGSMAIVGSMQSGLQGNHQTLFAKTILDGSMSLVFGASLGIGAAFSAVPVLLFEGAIALASTLIRDFLSPEIIREMSAVGSLIISAIGFNFLSIKEIKVANLIPAIFIPWVYLSLVGLISG*
Sample Types
Isolate
2.8%
Metagenome
97.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
47.9%
Kalotermitidae
29.2%
Unclassified
14.6%
Rhinotermitidae
4.2%
Termopsidae
4.2%
Taxonomy
Archaea
0
Bacteria
167
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 2 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 10 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 11 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 12 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 13 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 14 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 15 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 16 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 17 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 18 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 19 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 20 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 21 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 22 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 23 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 24 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 25 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 26 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 27 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 28 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 29 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 30 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 31 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 32 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 33 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 34 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 35 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 36 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 37 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 38 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 39 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 40 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 41 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 42 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 43 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 44 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 45 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 46 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 47 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 48 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 49 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 50 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 51 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466690_326568 | 3300042590 | Bacteria | 10988 |
| 2 | Ga0466691_048814 | 3300042593 | Bacteria | 10711 |
| 3 | Ga0466699_011587 | 3300042597 | Bacteria | 6662 |
| 4 | Ga0466699_172301 | 3300042597 | Bacteria | 1426 |
| 5 | Ga0466705_434571 | 3300042612 | Bacteria | 3703 |
| 6 | Ga0466715_236298 | 3300042616 | Bacteria | 9493 |
| 7 | Ga0466718_087149 | 3300042617 | Bacteria | 122153 |
| 8 | Ga0466700_061377 | 3300042600 | Bacteria | 2865 |
| 9 | Ga0466707_301169 | 3300042601 | Bacteria | 2581 |
| 10 | Ga0466719_431752 | 3300042606 | Bacteria | 3430 |
| 11 | Ga0466708_035817 | 3300042652 | Bacteria | 2751 |
| 12 | JGI24698J34947_10016178 | 3300002449 | Bacteria | 4051 |
| 13 | JGI24698J34947_10034433 | 3300002449 | Bacteria | 2650 |
| 14 | JGI24695J34938_10003494 | 3300002450 | Bacteria | 10924 |
| 15 | Ga0072941_1062130 | 3300005201 | Bacteria | 4086 |
| 16 | Ga0466705_164564 | 3300042612 | Bacteria | 12835 |
| 17 | Ga0123356_10054337 | 3300010049 | Bacteria | 3730 |
| 18 | Ga0123353_11135960 | 3300010167 | Bacteria | 1033 |
| 19 | Ga0264413_103165 | 3300024493 | Bacteria | 22797 |
| 20 | Ga0466693_039321 | 3300042592 | Bacteria | 1053 |
| 21 | Ga0466691_046731 | 3300042593 | Bacteria | 3208 |
| 22 | Ga0466694_064514 | 3300042594 | Bacteria | 49364 |
| 23 | Ga0466699_137948 | 3300042597 | Bacteria | 4250 |
| 24 | Ga0466699_397624 | 3300042597 | Bacteria | 1153 |
| 25 | Ga0466699_440015 | 3300042597 | Bacteria | 32912 |
| 26 | Ga0466705_494028 | 3300042612 | Unclassified | 2679 |
| 27 | Ga0466712_043197 | 3300042614 | Bacteria | 7077 |
| 28 | Ga0466711_462493 | 3300042615 | Bacteria | 5739 |
| 29 | Ga0466715_012042 | 3300042616 | Bacteria | 4403 |
| 30 | Ga0466715_487027 | 3300042616 | Bacteria | 6626 |
| 31 | Ga0466723_209011 | 3300042618 | Bacteria | 15064 |
| 32 | Ga0466723_245234 | 3300042618 | Bacteria | 2591 |
| 33 | Ga0466726_354863 | 3300042619 | Bacteria | 1525 |
| 34 | Ga0466707_126033 | 3300042601 | Bacteria | 1160 |
| 35 | Ga0466707_411877 | 3300042601 | Unclassified | 1510 |
| 36 | Ga0466717_079641 | 3300042604 | Bacteria | 1526 |
| 37 | Ga0466716_067187 | 3300042605 | Bacteria | 5258 |
| 38 | Ga0466719_006586 | 3300042606 | Bacteria | 18894 |
| 39 | Ga0466720_047994 | 3300042607 | Bacteria | 5761 |
| 40 | Ga0466704_264488 | 3300042643 | Bacteria | 21463 |
| 41 | AustNasuHG_c1029995 | 3300000089 | Bacteria | 1577 |
| 42 | Ga0068305_10037251 | 3300005083 | Bacteria | 9038 |
| 43 | Ga0072941_1021733 | 3300005201 | Bacteria | 5593 |
| 44 | Ga0123357_10215814 | 3300009784 | Bacteria | 2142 |
| 45 | Ga0123353_10493707 | 3300010167 | Bacteria | 1786 |
| 46 | Ga0264413_102917 | 3300024493 | Bacteria | 13297 |
| 47 | Ga0466699_090944 | 3300042597 | Bacteria | 2675 |
| 48 | Ga0466699_313585 | 3300042597 | Bacteria | 1719 |
| 49 | Ga0466711_190315 | 3300042615 | Bacteria | 2478 |
| 50 | Ga0466715_082784 | 3300042616 | Bacteria | 6715 |
| 51 | Ga0466715_565079 | 3300042616 | Bacteria | 3098 |
| 52 | Ga0466718_044781 | 3300042617 | Bacteria | 1246 |
| 53 | Ga0466718_162075 | 3300042617 | Bacteria | 47757 |
| 54 | Ga0466723_047296 | 3300042618 | Bacteria | 5957 |
| 55 | Ga0466723_146142 | 3300042618 | Bacteria | 10143 |
| 56 | Ga0466726_134572 | 3300042619 | Bacteria | 5026 |
| 57 | Ga0466716_447523 | 3300042605 | Bacteria | 3226 |
| 58 | Ga0466722_067842 | 3300042609 | Bacteria | 4251 |
| 59 | Ga0466703_075486 | 3300042636 | Bacteria | 14808 |
| 60 | Ga0466704_285386 | 3300042643 | Bacteria | 59541 |
| 61 | Ga0466704_410851 | 3300042643 | Bacteria | 5597 |
| 62 | AustNasuHG_c1009073 | 3300000089 | Bacteria | 3506 |
| 63 | FAAS_10004275 | 3300001880 | Bacteria | 1978 |
| 64 | JGI24698J34947_10047027 | 3300002449 | Bacteria | 2192 |
| 65 | Ga0072941_1133931 | 3300005201 | Bacteria | 1637 |
| 66 | Ga0466705_222780 | 3300042612 | Bacteria | 14007 |
| 67 | Ga0123353_10147089 | 3300010167 | Bacteria | 3766 |
| 68 | Ga0466699_139643 | 3300042597 | Bacteria | 7379 |
| 69 | Ga0466699_245235 | 3300042597 | Bacteria | 12904 |
| 70 | Ga0466699_291075 | 3300042597 | Bacteria | 6740 |
| 71 | Ga0466723_195461 | 3300042618 | Bacteria | 56859 |
| 72 | Ga0466723_228598 | 3300042618 | Bacteria | 1599 |
| 73 | Ga0466728_385708 | 3300042620 | Bacteria | 3101 |
| 74 | Ga0466719_017705 | 3300042606 | Bacteria | 7328 |
| 75 | Ga0466719_380003 | 3300042606 | Unclassified | 3834 |
| 76 | Ga0466720_125380 | 3300042607 | Bacteria | 10259 |
| 77 | Ga0466722_081427 | 3300042609 | Bacteria | 4221 |
| 78 | Ga0466722_202646 | 3300042609 | Bacteria | 9905 |
| 79 | Ga0466698_048912 | 3300042610 | Bacteria | 2203 |
| 80 | Ga0466731_340664 | 3300042622 | Bacteria | 2938 |
| 81 | Ga0466704_011249 | 3300042643 | Bacteria | 50690 |
| 82 | Ga0466704_475978 | 3300042643 | Bacteria | 49461 |
| 83 | Ga0466709_329039 | 3300042648 | Bacteria | 1476 |
| 84 | Ga0466708_023662 | 3300042652 | Bacteria | 18710 |
| 85 | Ga0466708_123502 | 3300042652 | Bacteria | 2556 |
| 86 | JGI24695J34938_10113803 | 3300002450 | Bacteria | 1102 |
| 87 | Ga0072941_1038594 | 3300005201 | Bacteria | 5808 |
| 88 | Ga0264413_105112 | 3300024493 | Bacteria | 5546 |
| 89 | Ga0264413_120521 | 3300024493 | Bacteria | 2540 |
| 90 | Ga0264413_128052 | 3300024493 | Bacteria | 2075 |
| 91 | Ga0466699_132682 | 3300042597 | Bacteria | 10933 |
| 92 | Ga0466699_202269 | 3300042597 | Bacteria | 1658 |
| 93 | Ga0466699_399605 | 3300042597 | Bacteria | 1620 |
| 94 | Ga0466699_403371 | 3300042597 | Bacteria | 10189 |
| 95 | Ga0466718_062067 | 3300042617 | Unclassified | 1201 |
| 96 | Ga0466707_061184 | 3300042601 | Unclassified | 3441 |
| 97 | Ga0466707_148334 | 3300042601 | Unclassified | 1558 |
| 98 | Ga0466707_375971 | 3300042601 | Bacteria | 1885 |
| 99 | Ga0466716_420165 | 3300042605 | Bacteria | 3861 |
| 100 | Ga0466719_092645 | 3300042606 | Bacteria | 2319 |
| 101 | Ga0466719_153419 | 3300042606 | Bacteria | 6557 |
| 102 | Ga0466703_063951 | 3300042636 | Unclassified | 5233 |
| 103 | Ga0466703_074286 | 3300042636 | Bacteria | 5805 |
| 104 | Ga0466704_066572 | 3300042643 | Bacteria | 4982 |
| 105 | Ga0466709_122280 | 3300042648 | Bacteria | 12917 |
| 106 | Ga0466708_305483 | 3300042652 | Bacteria | 13849 |
| 107 | JGI24695J34938_10017702 | 3300002450 | Bacteria | 3580 |
| 108 | Ga0466705_191661 | 3300042612 | Bacteria | 3530 |
| 109 | Ga0466732_082723 | 3300042656 | Bacteria | 5254 |
| 110 | Ga0123355_10000558 | 3300009826 | Bacteria | 49958 |
| 111 | Ga0123353_10484347 | 3300010167 | Bacteria | 1809 |
| 112 | Ga0466690_149512 | 3300042590 | Unclassified | 2789 |
| 113 | Ga0466690_248093 | 3300042590 | Bacteria | 2729 |
| 114 | Ga0466692_177400 | 3300042591 | Bacteria | 2247 |
| 115 | Ga0466691_107990 | 3300042593 | Bacteria | 10700 |
| 116 | Ga0466691_162851 | 3300042593 | Bacteria | 20155 |
| 117 | Ga0466694_043895 | 3300042594 | Bacteria | 10272 |
| 118 | Ga0466694_052011 | 3300042594 | Bacteria | 5030 |
| 119 | Ga0466694_070065 | 3300042594 | Bacteria | 1884 |
| 120 | Ga0466699_399540 | 3300042597 | Bacteria | 9041 |
| 121 | Ga0466705_404120 | 3300042612 | Bacteria | 15159 |
| 122 | Ga0466712_200360 | 3300042614 | Bacteria | 13582 |
| 123 | Ga0466715_179980 | 3300042616 | Bacteria | 8265 |
| 124 | Ga0466715_605099 | 3300042616 | Bacteria | 3052 |
| 125 | Ga0466723_091455 | 3300042618 | Bacteria | 5091 |
| 126 | Ga0466726_212704 | 3300042619 | Bacteria | 14720 |
| 127 | Ga0466726_217295 | 3300042619 | Bacteria | 1997 |
| 128 | Ga0466707_182077 | 3300042601 | Bacteria | 3611 |
| 129 | Ga0466719_223827 | 3300042606 | Bacteria | 1765 |
| 130 | Ga0466719_399420 | 3300042606 | Bacteria | 1031 |
| 131 | Ga0466722_084523 | 3300042609 | Bacteria | 6652 |
| 132 | Ga0466698_363296 | 3300042610 | Bacteria | 21780 |
| 133 | Ga0466704_145711 | 3300042643 | Bacteria | 2174 |
| 134 | Ga0466704_262869 | 3300042643 | Bacteria | 2126 |
| 135 | JGI24695J34938_10000309 | 3300002450 | Bacteria | 48089 |
| 136 | JGI24705J35276_12176257 | 3300002504 | Unclassified | 1330 |
| 137 | Ga0466705_018959 | 3300042612 | Bacteria | 2201 |
| 138 | Ga0123355_10304836 | 3300009826 | Bacteria | 2166 |
| 139 | Ga0123356_10019916 | 3300010049 | Bacteria | 6354 |
| 140 | Ga0264413_108763 | 3300024493 | Bacteria | 7383 |
| 141 | Ga0466690_243270 | 3300042590 | Bacteria | 4626 |
| 142 | Ga0466693_043420 | 3300042592 | Bacteria | 1443 |
| 143 | Ga0466691_105156 | 3300042593 | Bacteria | 8838 |
| 144 | Ga0466695_198312 | 3300042595 | Bacteria | 1397 |
| 145 | Ga0466696_062086 | 3300042596 | Unclassified | 5662 |
| 146 | Ga0466696_203580 | 3300042596 | Bacteria | 11030 |
| 147 | Ga0466712_014001 | 3300042614 | Bacteria | 8844 |
| 148 | Ga0466715_333263 | 3300042616 | Bacteria | 10713 |
| 149 | Ga0466718_044594 | 3300042617 | Bacteria | 2862 |
| 150 | Ga0466723_227778 | 3300042618 | Bacteria | 3376 |
| 151 | Ga0466723_356247 | 3300042618 | Bacteria | 1407 |
| 152 | Ga0466716_392815 | 3300042605 | Bacteria | 2030 |
| 153 | Ga0466722_019023 | 3300042609 | Bacteria | 8953 |
| 154 | Ga0466703_097633 | 3300042636 | Bacteria | 13588 |
| 155 | Ga0466703_196062 | 3300042636 | Bacteria | 7222 |
| 156 | Ga0466704_014013 | 3300042643 | Bacteria | 5895 |
| 157 | Ga0466704_491039 | 3300042643 | Bacteria | 4321 |
| 158 | Ga0466704_577719 | 3300042643 | Bacteria | 4423 |
| 159 | JGI24698J34947_10046581 | 3300002449 | Unclassified | 2205 |
| 160 | JGI24695J34938_10010628 | 3300002450 | Bacteria | 5023 |
| 161 | Ga0072940_1013283 | 3300005200 | Bacteria | 6694 |
| 162 | Ga0072941_1034401 | 3300005201 | Bacteria | 9527 |
| 163 | Ga0074263_118027 | 3300005485 | Unclassified | 5435 |
| 164 | Ga0466705_088424 | 3300042612 | Bacteria | 1190 |
| 165 | Ga0123353_10327020 | 3300010167 | Bacteria | 2323 |
| 166 | Ga0466692_081487 | 3300042591 | Bacteria | 1517 |
| 167 | Ga0466693_127080 | 3300042592 | Unclassified | 1150 |
| 168 | Ga0466691_120382 | 3300042593 | Bacteria | 7375 |
| 169 | Ga0466699_302358 | 3300042597 | Unclassified | 1249 |
| 170 | Ga0466699_376261 | 3300042597 | Bacteria | 4317 |
| 171 | Ga0466726_137247 | 3300042619 | Bacteria | 9135 |
| 172 | Ga0466722_206021 | 3300042609 | Bacteria | 8434 |
| 173 | Ga0466735_131818 | 3300042624 | Bacteria | 1972 |
| 174 | Ga0466702_179902 | 3300042635 | Bacteria | 71441 |
| 175 | Ga0466708_078211 | 3300042652 | Bacteria | 46711 |
| 176 | JGI24695J34938_10004175 | 3300002450 | Bacteria | 9613 |
| 177 | Ga0074263_103712 | 3300005485 | Unclassified | 2180 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF04474 | DUF554 | Protein of unknown function (DUF554) | 39 | 273 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.