Protein Family IF00280
Metagenome
Isolate
117
Members
45
Samples
110
Scaffolds
75.06
Avg Length
Representative Sequence
- ID
- 3300000089|AustNasuHG_c1002906|AustNasuHG_10029067
- Length
- 91 aa
- Sequence
- MLNNFLYYKIMSQSQSLKDAKPGSKVRVIKIGGIGPIKRRIMEMGLTKGVAVRIRKVAPFGDPMEIEVRGYELSLRKADAELIEVEPYVH*
Sample Types
Isolate
6.0%
Metagenome
94.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
34.9%
Kalotermitidae
25.6%
Unclassified
20.9%
Termopsidae
7.0%
Passalidae
4.7%
Stratiomyidae
2.3%
Rhinotermitidae
2.3%
Hodotermitidae
2.3%
Taxonomy
Archaea
3
Bacteria
102
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 2 | 2820671341 | Unclassified Firmicutes Co191P3bin20 | Isolate | Unclassified |
| 3 | 8030343600 | Proteiniborus sp. MB09-C3 | Isolate | Stratiomyidae |
| 4 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 5 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 6 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 7 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 8 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 9 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 10 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 11 | 2820272499 | Unclassified Firmicutes Th196P3bin18 | Isolate | Unclassified |
| 12 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 13 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 14 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 15 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 16 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 17 | 2820246658 | Unclassified Firmicutes Th196P3bin70 | Isolate | Unclassified |
| 18 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 19 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 20 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 21 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 22 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 23 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 24 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 25 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 26 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 27 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 28 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 29 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 30 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 31 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 32 | 2819998259 | Unclassified Spirochaetes Nc150P4bin23 | Isolate | Unclassified |
| 33 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 34 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 35 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 36 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 37 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 38 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 39 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 40 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 41 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 42 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 43 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 44 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 45 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466715_029604 | 3300042616 | Bacteria | 97338 |
| 2 | Ga0466715_300738 | 3300042616 | Bacteria | 3542 |
| 3 | Ga0466707_029374 | 3300042601 | Bacteria | 3463 |
| 4 | Ga0466707_301059 | 3300042601 | Bacteria | 29327 |
| 5 | Ga0466707_387908 | 3300042601 | Bacteria | 1235 |
| 6 | Ga0466698_326116 | 3300042610 | Unclassified | 1113 |
| 7 | Ga0466698_377350 | 3300042610 | Bacteria | 1723 |
| 8 | Ga0466698_466734 | 3300042610 | Bacteria | 1526 |
| 9 | Ga0466704_588329 | 3300042643 | Bacteria | 2446 |
| 10 | Ga0466708_368653 | 3300042652 | Bacteria | 3944 |
| 11 | Ga0466727_151368 | 3300042655 | Bacteria | 3590 |
| 12 | 2227544386 | 2225789004 | Unclassified | 2939 |
| 13 | IMNBL1DRAFT_c0042132 | 3300000062 | Bacteria | 1525 |
| 14 | FAAS_10242107 | 3300001880 | Bacteria | 573 |
| 15 | Ga0072940_1050110 | 3300005200 | Bacteria | 1760 |
| 16 | Ga0466733_076782 | 3300042659 | Bacteria | 1383 |
| 17 | Ga0466733_097984 | 3300042659 | Bacteria | 1217 |
| 18 | Ga0466706_061845 | 3300042599 | Bacteria | 8180 |
| 19 | Ga0466713_069636 | 3300042602 | Bacteria | 98037 |
| 20 | Ga0466713_083720 | 3300042602 | Bacteria | 2982 |
| 21 | Ga0466698_188950 | 3300042610 | Unclassified | 3547 |
| 22 | Ga0466698_370787 | 3300042610 | Bacteria | 1289 |
| 23 | Ga0466698_399075 | 3300042610 | Bacteria | 1383 |
| 24 | Ga0466698_475165 | 3300042610 | Unclassified | 1393 |
| 25 | Ga0466698_514579 | 3300042610 | Bacteria | 1219 |
| 26 | Ga0466696_169479 | 3300042596 | Bacteria | 14589 |
| 27 | Ga0466703_305468 | 3300042636 | Bacteria | 1061 |
| 28 | 2227270516 | 2225789004 | Bacteria | 1280 |
| 29 | AustNasuHG_c1013772 | 3300000089 | Bacteria | 2766 |
| 30 | AustNasuHG_c1017611 | 3300000089 | Unclassified | 2373 |
| 31 | JGI24695J34938_10000692 | 3300002450 | Bacteria | 31857 |
| 32 | Ga0123357_10978509 | 3300009784 | Unclassified | 530 |
| 33 | Ga0466733_017416 | 3300042659 | Bacteria | 2446 |
| 34 | Ga0466733_037388 | 3300042659 | Bacteria | 2940 |
| 35 | Ga0466718_009160 | 3300042617 | Bacteria | 14021 |
| 36 | Ga0466718_022531 | 3300042617 | Bacteria | 2414 |
| 37 | Ga0466718_117861 | 3300042617 | Bacteria | 2053 |
| 38 | Ga0466719_518958 | 3300042606 | Bacteria | 2779 |
| 39 | Ga0466698_255206 | 3300042610 | Unclassified | 1946 |
| 40 | Ga0466696_185493 | 3300042596 | Unclassified | 3316 |
| 41 | Ga0466699_324391 | 3300042597 | Bacteria | 3644 |
| 42 | Ga0466735_176774 | 3300042624 | Bacteria | 1055 |
| 43 | Ga0466702_132977 | 3300042635 | Bacteria | 1175 |
| 44 | 2227216907 | 2225789004 | Bacteria | 7529 |
| 45 | Ga0072941_1005047 | 3300005201 | Bacteria | 68948 |
| 46 | Ga0466712_091161 | 3300042614 | Bacteria | 14589 |
| 47 | Ga0466718_002271 | 3300042617 | Bacteria | 3230 |
| 48 | Ga0466714_008436 | 3300042603 | Bacteria | 1090 |
| 49 | Ga0466716_469112 | 3300042605 | Bacteria | 5224 |
| 50 | Ga0466719_269735 | 3300042606 | Unclassified | 5351 |
| 51 | Ga0466698_208272 | 3300042610 | Bacteria | 3496 |
| 52 | Ga0466691_043598 | 3300042593 | Bacteria | 1603 |
| 53 | Ga0466699_359606 | 3300042597 | Bacteria | 9816 |
| 54 | Ga0466703_376267 | 3300042636 | Bacteria | 9634 |
| 55 | Ga0466704_033932 | 3300042643 | Bacteria | 38425 |
| 56 | IMNBL1DRAFT_c0017679 | 3300000062 | Bacteria | 2990 |
| 57 | AustNasuHG_c1018669 | 3300000089 | Bacteria | 2285 |
| 58 | JGI24698J34947_10006769 | 3300002449 | Bacteria | 6296 |
| 59 | JGI24695J34938_10168205 | 3300002450 | Bacteria | 903 |
| 60 | Ga0466705_309740 | 3300042612 | Archaea | 2690 |
| 61 | Ga0466715_386054 | 3300042616 | Bacteria | 1299 |
| 62 | Ga0466718_021526 | 3300042617 | Bacteria | 1025 |
| 63 | Ga0466718_089439 | 3300042617 | Bacteria | 1130 |
| 64 | Ga0466726_359637 | 3300042619 | Bacteria | 1166 |
| 65 | Ga0466707_041888 | 3300042601 | Bacteria | 3061 |
| 66 | Ga0466707_060640 | 3300042601 | Bacteria | 27573 |
| 67 | Ga0466707_147968 | 3300042601 | Bacteria | 30910 |
| 68 | Ga0466713_115241 | 3300042602 | Bacteria | 1276 |
| 69 | Ga0466698_063372 | 3300042610 | Bacteria | 26845 |
| 70 | Ga0466698_145826 | 3300042610 | Bacteria | 1132 |
| 71 | Ga0466698_222589 | 3300042610 | Bacteria | 1161 |
| 72 | Ga0466693_123169 | 3300042592 | Bacteria | 1033 |
| 73 | Ga0072941_1171775 | 3300005201 | Bacteria | 2496 |
| 74 | Ga0072941_1213392 | 3300005201 | Bacteria | 1111 |
| 75 | Ga0466705_277513 | 3300042612 | Bacteria | 4100 |
| 76 | Ga0466732_245886 | 3300042656 | Bacteria | 6039 |
| 77 | Ga0466733_083052 | 3300042659 | Bacteria | 1079 |
| 78 | Ga0466715_580664 | 3300042616 | Bacteria | 23931 |
| 79 | Ga0466718_151772 | 3300042617 | Bacteria | 10955 |
| 80 | Ga0466728_391328 | 3300042620 | Bacteria | 1328 |
| 81 | Ga0466707_397030 | 3300042601 | Bacteria | 4195 |
| 82 | Ga0466720_057004 | 3300042607 | Bacteria | 41550 |
| 83 | Ga0466698_435841 | 3300042610 | Bacteria | 1560 |
| 84 | Ga0466692_175087 | 3300042591 | Bacteria | 69588 |
| 85 | AustNasuHG_c1017385 | 3300000089 | Archaea | 2393 |
| 86 | Ga0068305_10060996 | 3300005083 | Bacteria | 3048 |
| 87 | Ga0466732_063855 | 3300042656 | Bacteria | 20262 |
| 88 | Ga0466732_076479 | 3300042656 | Unclassified | 2588 |
| 89 | Ga0466732_258178 | 3300042656 | Bacteria | 2477 |
| 90 | Ga0466733_043662 | 3300042659 | Bacteria | 9609 |
| 91 | Ga0466718_013858 | 3300042617 | Bacteria | 2342 |
| 92 | Ga0466718_165876 | 3300042617 | Bacteria | 1515 |
| 93 | Ga0466723_321404 | 3300042618 | Bacteria | 2684 |
| 94 | Ga0466704_035255 | 3300042643 | Bacteria | 34206 |
| 95 | Ga0466704_060899 | 3300042643 | Bacteria | 1468 |
| 96 | Ga0466732_077410 | 3300042656 | Bacteria | 3893 |
| 97 | Ga0466733_154079 | 3300042659 | Bacteria | 1602 |
| 98 | Ga0466733_173002 | 3300042659 | Bacteria | 7289 |
| 99 | Ga0466718_035229 | 3300042617 | Bacteria | 9395 |
| 100 | Ga0466718_100104 | 3300042617 | Bacteria | 6237 |
| 101 | Ga0466707_051314 | 3300042601 | Bacteria | 1257 |
| 102 | Ga0466707_106366 | 3300042601 | Unclassified | 2433 |
| 103 | Ga0466719_312520 | 3300042606 | Bacteria | 1089 |
| 104 | Ga0466698_286511 | 3300042610 | Bacteria | 66842 |
| 105 | Ga0466698_289963 | 3300042610 | Unclassified | 1163 |
| 106 | Ga0466698_406757 | 3300042610 | Bacteria | 2056 |
| 107 | Ga0466727_227650 | 3300042655 | Bacteria | 12536 |
| 108 | AustNasuHG_c1002906 | 3300000089 | Bacteria | 6189 |
| 109 | JGI24695J34938_10002725 | 3300002450 | Bacteria | 13029 |
| 110 | Ga0072940_1014736 | 3300005200 | Archaea | 2273 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF04023 | FeoA | FeoA domain | 16 | 87 | 0.96 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF04023 | GO:0046914 | transition metal ion binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.