Protein Family IF00265

Metagenome Isolate
166 Members
54 Samples
153 Scaffolds
387.5 Avg Length

🧬 Representative Sequence

ID
3300000089|AustNasuHG_c1000374|AustNasuHG_100037415
Length
411 aa
Sequence
MKYDFDTVTDRSNSYSIKYEPSWRGKPDDVLPMWVADMDFPTPVCVQEALIRRARHGIFGYSEPEPQPGLTVGKRSGEGSPPDAGYFDVTRNWFEERFNWPVRREWLAVTPGVVNAIYLAVRALTKPGDGVVIQQPVYYPFESSVRKTGRQLLVNELVYGEGRYSIDFQDFEEKIKQAKLFILCSPHNPVGRVWKRDELVRMGEICLRHGVKVIADEIHQDFVFENHRHLVFAALSEDFADITVTCTSPSKTFNIASLLVANIFISNRELRDKFKEEYAACGLSQPGVMGLAACKAAYQDGAEWLERLIDYLAGNMLFLKTYLSQNIPKIKLVEPEGTYLAWLDCNSLGLSAKRLDETLIHKGKLWLSAGHSFGKGGDGFQRMNVACPRSVLSNALERLQKTDWNNADRA*

📊 Sample Types

Isolate 7.8%
Metagenome 92.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 49.0%
Unclassified 31.4%
Kalotermitidae 11.8%
Passalidae 3.9%
Rhinotermitidae 2.0%
Termopsidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 157
Eukaryota 0
Viruses 0
Unclassified 9

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
2 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
3 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
4 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
5 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
6 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
7 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
8 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
9 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
10 2820806175 Unclassified Actinobacteria Th196P3bin122 Isolate Unclassified
11 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
12 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
13 2820121232 Unclassified Proteobacteria Emb289P4bin32 Isolate Unclassified
14 2758568796 Unclassified Deltaproteobacteria Th196P3_bin21 Isolate Unclassified
15 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
16 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
17 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
18 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
19 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
20 2030936001 Nasutitermes corniger hindgut microbial communities from Florida, USA Metagenome Termitidae
21 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
22 2820254385 Unclassified Firmicutes Th196P3bin54 Isolate Unclassified
23 2820285501 Unclassified Firmicutes Th196P3bin142 Isolate Unclassified
24 2820716747 Unclassified Fibrobacteres Nc150P3bin18 Isolate Unclassified
25 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
26 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
27 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
28 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
29 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
30 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
31 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
32 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
33 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
34 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
35 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
36 2228664003 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA Metagenome Termitidae
37 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
38 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
39 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
40 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
41 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
42 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
43 2820077244 Unclassified Proteobacteria Lab288P4bin72 Isolate Unclassified
44 2820666966 Unclassified Firmicutes Co191P3bin39 Isolate Unclassified
45 3300007733 Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean Metagenome
46 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
47 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
48 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
49 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
50 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
51 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
52 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
53 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
54 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_286668 3300042656 Bacteria 1509
2 Ga0466732_403274 3300042656 Bacteria 24522
3 Ga0264413_100872 3300024493 Bacteria 3320
4 Ga0264413_107524 3300024493 Bacteria 2618
5 Ga0264413_124465 3300024493 Bacteria 1956
6 Ga0466693_044474 3300042592 Bacteria 2712
7 Ga0466699_305929 3300042597 Bacteria 25158
8 Ga0123357_10008156 3300009784 Bacteria 13053
9 Ga0123353_10004048 3300010167 Bacteria 18786
10 Ga0123354_10237088 3300010882 Unclassified 1888
11 AustNasuHG_c1030338 3300000089 Bacteria 1558
12 JGI24698J34947_10009006 3300002449 Bacteria 5473
13 JGI24698J34947_10012086 3300002449 Bacteria 4738
14 JGI24698J34947_10018204 3300002449 Bacteria 3798
15 JGI24698J34947_10084084 3300002449 Bacteria 1483
16 JGI24695J34938_10017306 3300002450 Unclassified 3636
17 Ga0466718_007509 3300042617 Bacteria 13560
18 Ga0466718_028092 3300042617 Bacteria 1582
19 Ga0466718_053873 3300042617 Bacteria 3490
20 Ga0466718_107826 3300042617 Bacteria 11605
21 Ga0466707_187582 3300042601 Unclassified 4256
22 Ga0466714_097870 3300042603 Bacteria 6473
23 Ga0466699_282721 3300042597 Bacteria 2577
24 Ga0123353_10048590 3300010167 Bacteria 6756
25 AustNasuHG_c1000507 3300000089 Bacteria 13650
26 AustNasuHG_c1001331 3300000089 Bacteria 8852
27 AustNasuHG_c1003924 3300000089 Bacteria 5358
28 AustNasuHG_c1026651 3300000089 Bacteria 1795
29 JGI24698J34947_10011543 3300002449 Bacteria 4850
30 JGI24702J35022_10037070 3300002462 Bacteria 2604
31 Ga0072941_1013419 3300005201 Bacteria 2730
32 Ga0074263_112765 3300005485 Bacteria 3904
33 Ga0466712_013069 3300042614 Bacteria 3479
34 Ga0466712_173237 3300042614 Bacteria 5964
35 Ga0466712_283315 3300042614 Bacteria 3507
36 Ga0466718_001274 3300042617 Bacteria 10716
37 Ga0466718_064984 3300042617 Bacteria 4743
38 Ga0466718_075123 3300042617 Bacteria 21718
39 Ga0466718_102839 3300042617 Bacteria 6600
40 Ga0466718_110844 3300042617 Bacteria 2103
41 Ga0466720_043368 3300042607 Bacteria 6140
42 Ga0466720_064317 3300042607 Bacteria 1289
43 Ga0466720_077001 3300042607 Bacteria 21582
44 Ga0466720_087013 3300042607 Bacteria 4546
45 Ga0466720_154187 3300042607 Bacteria 6484
46 Ga0466722_185810 3300042609 Bacteria 1862
47 Ga0466702_191715 3300042635 Bacteria 26537
48 Ga0466693_418242 3300042592 Bacteria 1480
49 Nasutiter_Contig47356 2030936001 Bacteria 2829
50 2227005366 2225789003 Bacteria 5828
51 IMNBL1DRAFT_c0000090 3300000062 Bacteria 79466
52 AustNasuHG_c1000374 3300000089 Bacteria 15530
53 AustNasuHG_c1001502 3300000089 Bacteria 8369
54 AustNasuHG_c1003629 3300000089 Bacteria 5568
55 JGI24695J34938_10000001 3300002450 Bacteria 290906
56 Ga0072941_1114054 3300005201 Unclassified 3856
57 Ga0074263_112415 3300005485 Bacteria 5192
58 Ga0466718_076603 3300042617 Bacteria 3353
59 Ga0466718_116147 3300042617 Bacteria 3228
60 Ga0466720_043019 3300042607 Bacteria 33576
61 Ga0466720_133290 3300042607 Bacteria 2551
62 Ga0466720_165599 3300042607 Bacteria 1881
63 Ga0466732_014517 3300042656 Bacteria 35197
64 Ga0466699_000916 3300042597 Bacteria 4898
65 Ga0123356_10225461 3300010049 Bacteria 1934
66 Ga0123353_10313883 3300010167 Bacteria 2383
67 Ga0123353_10643453 3300010167 Bacteria 1503
68 Ga0123354_10000002 3300010882 Bacteria 317342
69 AustNasuHG_c1001180 3300000089 Bacteria 9391
70 Ga0072940_1025541 3300005200 Bacteria 5133
71 Ga0074263_103471 3300005485 Bacteria 2413
72 Ga0074263_106300 3300005485 Unclassified 3108
73 Ga0466712_299268 3300042614 Bacteria 10576
74 Ga0466718_050134 3300042617 Bacteria 6169
75 Ga0466718_113700 3300042617 Bacteria 3174
76 Ga0466723_257241 3300042618 Bacteria 25633
77 Ga0466707_188204 3300042601 Bacteria 1866
78 Ga0466720_094435 3300042607 Bacteria 70325
79 Ga0466720_156324 3300042607 Bacteria 70548
80 Ga0466698_017360 3300042610 Bacteria 19568
81 Ga0466697_180124 3300042611 Bacteria 1832
82 Ga0466705_029267 3300042612 Bacteria 5853
83 Ga0466732_019579 3300042656 Bacteria 4920
84 Ga0466732_026108 3300042656 Bacteria 105556
85 Ga0466732_053886 3300042656 Bacteria 35511
86 Ga0466732_150001 3300042656 Bacteria 2833
87 Ga0466709_314127 3300042648 Bacteria 22341
88 Ga0264413_122574 3300024493 Bacteria 2312
89 AustNasuHG_c1001975 3300000089 Bacteria 7371
90 JGI24698J34947_10000024 3300002449 Bacteria 40348
91 Ga0072941_1208709 3300005201 Bacteria 2285
92 Ga0105524_102654 3300007733 Bacteria 6903
93 Ga0466711_435051 3300042615 Bacteria 2275
94 Ga0466716_015576 3300042605 Unclassified 7249
95 Ga0466720_077927 3300042607 Bacteria 13582
96 Ga0466720_081496 3300042607 Bacteria 30339
97 Ga0466720_101321 3300042607 Bacteria 15125
98 Ga0466720_135647 3300042607 Bacteria 35375
99 Ga0466720_151106 3300042607 Bacteria 2129
100 Ga0466732_068648 3300042656 Bacteria 2008
101 Ga0264413_103012 3300024493 Bacteria 9110
102 Ga0264413_109375 3300024493 Bacteria 15984
103 Ga0264413_110637 3300024493 Bacteria 18182
104 Ga0415639_035793 3300038395 Bacteria 3288
105 Ga0466695_293359 3300042595 Bacteria 3728
106 Ga0123353_10460641 3300010167 Bacteria 1868
107 2230954185 2228664003 Bacteria 26898
108 AustNasuHG_c1017322 3300000089 Bacteria 2400
109 JGI24695J34938_10025831 3300002450 Bacteria 2800
110 Ga0466718_019988 3300042617 Bacteria 93292
111 Ga0466718_055777 3300042617 Bacteria 6017
112 Ga0466726_006341 3300042619 Bacteria 2588
113 Ga0466707_335734 3300042601 Bacteria 20969
114 Ga0466713_069416 3300042602 Bacteria 2604
115 Ga0466713_110129 3300042602 Bacteria 29275
116 Ga0466717_192414 3300042604 Bacteria 4309
117 Ga0466720_023972 3300042607 Bacteria 2276
118 Ga0466720_123207 3300042607 Bacteria 17586
119 Ga0466732_184963 3300042656 Bacteria 4445
120 Ga0264413_108226 3300024493 Bacteria 11454
121 Ga0466699_085374 3300042597 Bacteria 1346
122 Ga0123354_10016224 3300010882 Unclassified 11670
123 JGI24695J34938_10000530 3300002450 Bacteria 36998
124 Ga0072941_1038254 3300005201 Bacteria 6621
125 Ga0072941_1272681 3300005201 Bacteria 1985
126 Ga0466712_002176 3300042614 Bacteria 2682
127 Ga0466712_137892 3300042614 Bacteria 4256
128 Ga0466715_114775 3300042616 Bacteria 4942
129 Ga0466715_483038 3300042616 Unclassified 6363
130 Ga0466718_040946 3300042617 Bacteria 15501
131 Ga0466718_054014 3300042617 Bacteria 3465
132 Ga0466718_091758 3300042617 Bacteria 1223
133 Ga0466720_026610 3300042607 Bacteria 8539
134 Ga0466720_100648 3300042607 Bacteria 5841
135 Ga0466720_150948 3300042607 Bacteria 14139
136 Ga0466720_218580 3300042607 Bacteria 1619
137 Ga0264413_108323 3300024493 Bacteria 7867
138 AustNasuHG_c1028967 3300000089 Bacteria 1638
139 JGI24698J34947_10009717 3300002449 Bacteria 5271
140 JGI24698J34947_10034555 3300002449 Bacteria 2644
141 JGI24695J34938_10063197 3300002450 Bacteria 1570
142 Ga0068305_10001080 3300005083 Unclassified 53401
143 Ga0072941_1075281 3300005201 Bacteria 4658
144 Ga0074263_104405 3300005485 Bacteria 1395
145 Ga0074263_107381 3300005485 Bacteria 2122
146 Ga0074263_108345 3300005485 Bacteria 8414
147 Ga0466712_262598 3300042614 Bacteria 4599
148 Ga0466718_025038 3300042617 Bacteria 6773
149 Ga0466718_032860 3300042617 Bacteria 11807
150 Ga0466720_019561 3300042607 Bacteria 19292
151 Ga0466720_120113 3300042607 Bacteria 8336
152 Ga0466720_181617 3300042607 Bacteria 1839
153 Ga0466720_191951 3300042607 Bacteria 17822

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00155 Aminotran_1_2 Aminotransferase class I and II 102 399 0.91

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.