Protein Family IF00191
Metagenome
Isolate
136
Members
48
Samples
126
Scaffolds
230.52
Avg Length
Representative Sequence
- ID
- 3300000062|IMNBL1DRAFT_c0000125|IMNBL1DRAFT_000012546
- Length
- 254 aa
- Sequence
- MMNFNFIINQSYFNFVSCYKTKIQMTNFYSREDKLFVAVDCIILGFKDHEINVLIIKRKFDPLKGGRSLMGGFVREKEALNDTVTRVVAEYTGVENMYMEQVGTYGEIERDLGERVITIVYYALIDMEKFDEKLQKKHDAEWININDVGTLVLDHNQILTDTIKLLQLRTATRPVGFNLLPEKFTLPQLQSLYEAIYQKPLDKRNFRKKVLEMDILERLEEKDKSSSKRGAYLYKFNKEKYDSLLEEGFYFSL*
Sample Types
Isolate
7.3%
Metagenome
92.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
29.8%
Termitidae
17.0%
Blattidae
12.8%
Unclassified
8.5%
Rhinotermitidae
8.5%
Termopsidae
6.4%
Culicidae
6.4%
Passalidae
4.3%
Hydrophilidae
2.1%
Apidae
2.1%
Armadillidiidae
2.1%
Taxonomy
Archaea
0
Bacteria
130
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 3 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 4 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 12 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 13 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 14 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 15 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 16 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 17 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 18 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 19 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 20 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 21 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 22 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 23 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 24 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 25 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 26 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 27 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 28 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 29 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 30 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 31 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 32 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 33 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 34 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 35 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 36 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 37 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 38 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 39 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 40 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 41 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 42 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 43 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 44 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 45 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 46 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 47 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 48 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466729_286958 | 3300042621 | Bacteria | 1293 |
| 2 | Ga0466735_012966 | 3300042624 | Bacteria | 3462 |
| 3 | Ga0466735_079622 | 3300042624 | Bacteria | 3451 |
| 4 | Ga0466704_172969 | 3300042643 | Bacteria | 12357 |
| 5 | Ga0466705_451616 | 3300042612 | Bacteria | 5616 |
| 6 | Ga0466715_013663 | 3300042616 | Unclassified | 16200 |
| 7 | Ga0466715_274249 | 3300042616 | Bacteria | 11120 |
| 8 | Ga0466726_132684 | 3300042619 | Bacteria | 8466 |
| 9 | Ga0160446_100006 | 3300012835 | Bacteria | 445354 |
| 10 | Ga0466691_073635 | 3300042593 | Bacteria | 11602 |
| 11 | Ga0466691_094074 | 3300042593 | Bacteria | 24969 |
| 12 | Ga0466707_137647 | 3300042601 | Bacteria | 5043 |
| 13 | Ga0466707_302666 | 3300042601 | Unclassified | 6353 |
| 14 | Ga0466713_019038 | 3300042602 | Bacteria | 32605 |
| 15 | Ga0466713_112154 | 3300042602 | Bacteria | 38459 |
| 16 | Ga0466719_561083 | 3300042606 | Bacteria | 10483 |
| 17 | Ga0466733_197920 | 3300042659 | Bacteria | 2844 |
| 18 | Ga0466704_082791 | 3300042643 | Bacteria | 24873 |
| 19 | Ga0466704_256491 | 3300042643 | Bacteria | 12118 |
| 20 | Ga0466709_208869 | 3300042648 | Bacteria | 17257 |
| 21 | Ga0466708_259041 | 3300042652 | Bacteria | 17584 |
| 22 | Ga0466711_118037 | 3300042615 | Bacteria | 1715 |
| 23 | Ga0466711_152207 | 3300042615 | Bacteria | 2161 |
| 24 | Ga0466715_180477 | 3300042616 | Bacteria | 7005 |
| 25 | Ga0466723_023862 | 3300042618 | Bacteria | 63714 |
| 26 | Ga0466726_404308 | 3300042619 | Bacteria | 9418 |
| 27 | Ga0466728_088307 | 3300042620 | Bacteria | 7862 |
| 28 | Ga0160472_100653 | 3300012839 | Bacteria | 17639 |
| 29 | Ga0466691_023961 | 3300042593 | Bacteria | 17173 |
| 30 | Ga0466696_286046 | 3300042596 | Bacteria | 11686 |
| 31 | Ga0466713_094496 | 3300042602 | Bacteria | 333875 |
| 32 | Ga0466719_156435 | 3300042606 | Bacteria | 3666 |
| 33 | 2227545478 | 2225789004 | Bacteria | 2926 |
| 34 | Ga0466697_158902 | 3300042611 | Bacteria | 1881 |
| 35 | Ga0466703_031196 | 3300042636 | Bacteria | 8277 |
| 36 | Ga0466703_060810 | 3300042636 | Bacteria | 10071 |
| 37 | Ga0466703_063257 | 3300042636 | Bacteria | 21853 |
| 38 | Ga0466703_275324 | 3300042636 | Bacteria | 50115 |
| 39 | Ga0466715_109715 | 3300042616 | Bacteria | 9701 |
| 40 | Ga0466715_256414 | 3300042616 | Bacteria | 4295 |
| 41 | Ga0160453_100804 | 3300012814 | Bacteria | 16822 |
| 42 | Ga0466656_258586 | 3300042550 | Bacteria | 1441 |
| 43 | Ga0466690_228091 | 3300042590 | Bacteria | 31086 |
| 44 | Ga0466713_052862 | 3300042602 | Bacteria | 42531 |
| 45 | Ga0466716_140503 | 3300042605 | Bacteria | 8662 |
| 46 | Ga0466722_254735 | 3300042609 | Bacteria | 6616 |
| 47 | 2227340517 | 2225789004 | Bacteria | 1158 |
| 48 | 2227489373 | 2225789004 | Bacteria | 4138 |
| 49 | Ga0466705_279583 | 3300042612 | Bacteria | 6152 |
| 50 | Ga0466733_035826 | 3300042659 | Bacteria | 26745 |
| 51 | Ga0466733_098622 | 3300042659 | Bacteria | 1728 |
| 52 | Ga0466703_186119 | 3300042636 | Bacteria | 15613 |
| 53 | Ga0466703_403611 | 3300042636 | Bacteria | 9899 |
| 54 | Ga0466703_426220 | 3300042636 | Bacteria | 39212 |
| 55 | Ga0466704_012096 | 3300042643 | Bacteria | 26124 |
| 56 | Ga0466704_545894 | 3300042643 | Bacteria | 13346 |
| 57 | Ga0466727_124195 | 3300042655 | Bacteria | 107642 |
| 58 | Ga0466715_035702 | 3300042616 | Bacteria | 4005 |
| 59 | Ga0466723_101690 | 3300042618 | Bacteria | 10611 |
| 60 | Ga0466696_265860 | 3300042596 | Bacteria | 11142 |
| 61 | Ga0466716_081450 | 3300042605 | Bacteria | 2137 |
| 62 | Ga0466719_404744 | 3300042606 | Bacteria | 1677 |
| 63 | Ga0123357_10435667 | 3300009784 | Unclassified | 1153 |
| 64 | Ga0466733_156676 | 3300042659 | Bacteria | 5578 |
| 65 | Ga0466703_132942 | 3300042636 | Bacteria | 7817 |
| 66 | Ga0466704_081344 | 3300042643 | Bacteria | 118045 |
| 67 | Ga0466704_204146 | 3300042643 | Bacteria | 4499 |
| 68 | Ga0466708_139687 | 3300042652 | Bacteria | 1127 |
| 69 | Ga0466711_337203 | 3300042615 | Bacteria | 5009 |
| 70 | Ga0466711_480807 | 3300042615 | Bacteria | 7985 |
| 71 | Ga0466715_038410 | 3300042616 | Bacteria | 19135 |
| 72 | Ga0466715_141137 | 3300042616 | Bacteria | 11682 |
| 73 | Ga0466728_218501 | 3300042620 | Bacteria | 3266 |
| 74 | Ga0466728_279239 | 3300042620 | Bacteria | 3212 |
| 75 | Ga0466728_284552 | 3300042620 | Bacteria | 12713 |
| 76 | Ga0160460_101249 | 3300012845 | Bacteria | 9373 |
| 77 | Ga0466690_270167 | 3300042590 | Bacteria | 35972 |
| 78 | Ga0466692_063097 | 3300042591 | Bacteria | 2249 |
| 79 | Ga0466692_117004 | 3300042591 | Bacteria | 3220 |
| 80 | Ga0466696_415123 | 3300042596 | Bacteria | 1146 |
| 81 | Ga0466707_076992 | 3300042601 | Bacteria | 3972 |
| 82 | Ga0466707_082408 | 3300042601 | Bacteria | 3566 |
| 83 | Ga0466707_104581 | 3300042601 | Bacteria | 5436 |
| 84 | Ga0466707_164963 | 3300042601 | Bacteria | 15338 |
| 85 | Ga0123354_10142833 | 3300010882 | Bacteria | 2949 |
| 86 | IMNBL1DRAFT_c0002054 | 3300000062 | Bacteria | 14385 |
| 87 | JGI24702J35022_10438377 | 3300002462 | Bacteria | 794 |
| 88 | Ga0466703_220245 | 3300042636 | Bacteria | 1741 |
| 89 | Ga0466704_106931 | 3300042643 | Bacteria | 4779 |
| 90 | Ga0466704_195138 | 3300042643 | Bacteria | 14925 |
| 91 | Ga0466709_404800 | 3300042648 | Bacteria | 4349 |
| 92 | Ga0466725_089174 | 3300042654 | Bacteria | 11445 |
| 93 | Ga0466711_104172 | 3300042615 | Bacteria | 17590 |
| 94 | Ga0466729_178010 | 3300042621 | Bacteria | 1330 |
| 95 | Ga0160445_100207 | 3300012847 | Bacteria | 44365 |
| 96 | Ga0466692_123090 | 3300042591 | Bacteria | 15817 |
| 97 | Ga0466691_206225 | 3300042593 | Bacteria | 5938 |
| 98 | Ga0466719_030097 | 3300042606 | Bacteria | 1529 |
| 99 | Ga0466719_471103 | 3300042606 | Bacteria | 2096 |
| 100 | IMNBL1DRAFT_c0000125 | 3300000062 | Bacteria | 68757 |
| 101 | Ga0068305_10013323 | 3300005083 | Bacteria | 8419 |
| 102 | Ga0466733_010915 | 3300042659 | Unclassified | 1972 |
| 103 | Ga0466735_005040 | 3300042624 | Bacteria | 4201 |
| 104 | Ga0466735_235419 | 3300042624 | Bacteria | 1500 |
| 105 | Ga0466704_011408 | 3300042643 | Bacteria | 2297 |
| 106 | Ga0466704_196130 | 3300042643 | Bacteria | 1640 |
| 107 | Ga0466709_164307 | 3300042648 | Bacteria | 50982 |
| 108 | Ga0466708_083525 | 3300042652 | Bacteria | 1198 |
| 109 | Ga0466727_105126 | 3300042655 | Bacteria | 17217 |
| 110 | Ga0466727_308857 | 3300042655 | Bacteria | 2912 |
| 111 | Ga0466711_033361 | 3300042615 | Bacteria | 49617 |
| 112 | Ga0466711_265445 | 3300042615 | Bacteria | 9284 |
| 113 | Ga0466715_047111 | 3300042616 | Bacteria | 5769 |
| 114 | Ga0466723_221705 | 3300042618 | Bacteria | 9345 |
| 115 | Ga0466707_009170 | 3300042601 | Bacteria | 5684 |
| 116 | Ga0466707_089415 | 3300042601 | Unclassified | 7230 |
| 117 | Ga0466707_116649 | 3300042601 | Unclassified | 1474 |
| 118 | Ga0466716_499897 | 3300042605 | Bacteria | 17414 |
| 119 | Ga0466722_073126 | 3300042609 | Bacteria | 1178 |
| 120 | IMNBL1DRAFT_c0002398 | 3300000062 | Bacteria | 13047 |
| 121 | Ga0466735_046963 | 3300042624 | Bacteria | 3941 |
| 122 | Ga0466735_076481 | 3300042624 | Bacteria | 1499 |
| 123 | Ga0466715_057348 | 3300042616 | Bacteria | 36717 |
| 124 | Ga0466707_045810 | 3300042601 | Bacteria | 3043 |
| 125 | Ga0466714_104394 | 3300042603 | Bacteria | 4379 |
| 126 | 2227652397 | 2225789004 | Bacteria | 10757 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF19368 | GO:0003677 | DNA binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.