Protein Family IF00171

Metagenome Isolate
145 Members
47 Samples
126 Scaffolds
1473.03 Avg Length

🧬 Representative Sequence

ID
2225789004|2227663513|2228265340
Length
1532 aa
Sequence
MLQKNLYHPDYEHDACGVGLLVDIYGKKTHDIVEKGLQVLENMVHRGAESADNKTGDGAGIMLQIPHEFILLQGIPVPEKGRYGTGLIFLPKNDEEASLCMDIVESVLEQEELRLLAVRDVQVCSDVLGEISKGNEPAIKQIFVVDSSSSLEFRLYVARKKIEKKILKSAIPNRRSFYVVSLSSQRIIYKGMLTSTQLREYFPDLVNPYFTSGLALVHSRFSTNTFPSWDLAQPFRFLGHNGEINTIRGNRYWMEAREELFGASSVESGKWRSKKKKLSTLNSQLSTKEDSLLSTLNSESIFPIIQQGMSDSASLDNVLEFLVMSGKSLPHALAMLVPESMNDKNPISPELKAFYEYHSLLMEPWDGPATILFTDGRYAGGMLDRNGLRPARYFITKNDIMVVASEAGVLPFDASEIRKKGRLQPGKMLMVDMQEGTVKYDPELKAELANAFPYAEWLSENRILLSNISSGRTVRYTVDNFDAHLRAFGYSKEDVERIILPMTIDGKEPVGSMGNDTPLAVLSDKPQLLFNYFRQLFAQVTNPPIDPIREELVMSLSLYIGCQDTNLLTPSPDLCKMVKLESPVINNDGLDILTHLGYKHFRTKVLPMLFDATASDPVDSMAKALTLLCQQAEEAVVEEYNYIILSDRGINEKMAAIPSLLAVSAVHHHLIEKRKRMQIAIVVETAEAREVMHFALLFGFGASAVNPYMAFAILDEKVKSHEIQLDYHTAEKHYIKSINKGLLKVLSKMGISTLRSYRGAQIFEAVGISQALLDRYFRGMTSPIGGIELDDIVRDVLIAHSKAFSPLSTLNSQLFTEGVYSYRKGGEVHAWNPETISKLQIATRLGDYSKFKEYTRIVDEKIQPIFLRDFLTYKRAATGPANNTNKAALEVDVVGNSAYTRKPISIDEVEPVEAITKRFVTGAMSFGSISKEAHEAMAIALNILKGRSNTGEGGEDPERFKVGEDGLNRRSAIKQIASGRFGVTAEYLVNADELQIKVAQGAKPGEGGQLPGFKVNKIIAQTRHSIPGITLISPPPHHDIYSIEDLAQLIFDLKNINPQAEISVKLVAESGVGTIAAGVAKAKADRIVISGSEGGTGASPVSSIRHAGSAGELGLAEVQQTLVMNNLRGNVRLQADGQLKTGKDIITSALLGAEEFGFATSALIVLGCVMMRKCHLNTCPVGVATQDEKLRARFKGKHEYLVNFMTFLAEEVREHLAQMGFRSMDEIIGRADLLEKRCFQEENEDASCNHKVAKLNLSKLTYFADCDNDIRCTKTQDHKIDKVLDRELIKKAKLSIEKALPVEMKMQIANTDRSVGAMLSGEVAKKYGNTGLPDGTIVTKLCGSAGQSFGAFLAGGITFRLEGEANDYLGKGLSGXRIIVVPPHNSTFPPEENIIAGNTLLYGATSGEVYINGMVGERFCVRNSGAIAVVEGVGDHCCEYMLDMDGRFDYFCNMEMIELTLVEDKTDNRELHRLISAHAGYTQSPLAKKILADWDNYLKHFIKVTPIEYKKVLQEEKIEAINKRIAQVEHDY

📊 Sample Types

Isolate 13.1%
Metagenome 86.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 30.4%
Unclassified 15.2%
Blattidae 15.2%
Apidae 10.9%
Rhinotermitidae 8.7%
Termopsidae 6.5%
Hydrophilidae 4.3%
Passalidae 4.3%
Hodotermitidae 2.2%
Termitidae 2.2%

🌳 Taxonomy

Archaea 1
Bacteria 141
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
2 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
3 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
4 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
5 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
6 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
7 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
8 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
9 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
10 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
11 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
12 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
13 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
14 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
15 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
16 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
17 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
18 2832343623 Apibacter adventoris wkB180 Isolate Apidae
19 2923982719 Parabacteroides sp. 52 Isolate Blattidae
20 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
21 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
22 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
23 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
24 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
25 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
26 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
27 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
28 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
29 2799112231 Apibacter sp. ESL0432 Isolate Unclassified
30 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
31 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
32 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
33 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
34 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
35 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
36 2832372155 Apibacter adventoris wkB301 Isolate Apidae
37 2920168565 Paludibacter sp. 221 Isolate Blattidae
38 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
39 2832298047 Apibacter sp. wkB309 Isolate Apidae
40 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
41 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
42 643348524 Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 Isolate Unclassified
43 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
44 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
45 2785510743 Apibacter sp. ESL0404 Isolate Apidae
46 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
47 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466706_122623 3300042599 Bacteria 44263
2 Ga0466716_398226 3300042605 Bacteria 12743
3 Ga0466719_155715 3300042606 Bacteria 13693
4 Ga0466703_257396 3300042636 Bacteria 15106
5 Ga0466704_150725 3300042643 Bacteria 13396
6 Ga0466709_345527 3300042648 Bacteria 65587
7 Ga0466709_361113 3300042648 Bacteria 7904
8 Ga0466708_275929 3300042652 Bacteria 19874
9 Ga0466708_299349 3300042652 Bacteria 43943
10 Ga0466690_024417 3300042590 Bacteria 8380
11 Ga0466690_048635 3300042590 Bacteria 14569
12 Ga0466692_059014 3300042591 Bacteria 6928
13 Ga0466692_066865 3300042591 Bacteria 168349
14 Ga0466696_293717 3300042596 Bacteria 8555
15 Ga0466726_104123 3300042619 Unclassified 6978
16 Ga0466705_055877 3300042612 Bacteria 9899
17 Ga0466705_101004 3300042612 Bacteria 23546
18 Ga0466706_012301 3300042599 Bacteria 8050
19 Ga0466716_003945 3300042605 Bacteria 9817
20 Ga0466716_102876 3300042605 Bacteria 11206
21 Ga0466716_449356 3300042605 Bacteria 31338
22 Ga0466722_024099 3300042609 Bacteria 30187
23 Ga0466722_096505 3300042609 Bacteria 4798
24 Ga0466708_155893 3300042652 Bacteria 9404
25 Ga0466708_259456 3300042652 Bacteria 10354
26 Ga0466727_298515 3300042655 Bacteria 5481
27 Ga0466690_169422 3300042590 Bacteria 39612
28 Ga0466690_310829 3300042590 Bacteria 5001
29 Ga0466696_139050 3300042596 Bacteria 18174
30 2227663513 2225789004 Bacteria 10408
31 IMNBL1DRAFT_c0001562 3300000062 Bacteria 17042
32 Ga0466711_454301 3300042615 Bacteria 18317
33 Ga0466715_044260 3300042616 Bacteria 13404
34 Ga0466715_231804 3300042616 Bacteria 12015
35 Ga0466723_026213 3300042618 Bacteria 14458
36 Ga0466705_265643 3300042612 Bacteria 15146
37 Ga0466706_063924 3300042599 Bacteria 13148
38 Ga0466706_070140 3300042599 Bacteria 35282
39 Ga0466713_145668 3300042602 Bacteria 9598
40 Ga0466716_042283 3300042605 Bacteria 46440
41 Ga0466722_206312 3300042609 Bacteria 50435
42 Ga0466722_252821 3300042609 Bacteria 235840
43 Ga0466704_024708 3300042643 Bacteria 42885
44 Ga0466704_055758 3300042643 Unclassified 13348
45 Ga0466704_177078 3300042643 Bacteria 55313
46 Ga0466704_524377 3300042643 Bacteria 20150
47 Ga0466708_015517 3300042652 Bacteria 5785
48 Ga0466727_104042 3300042655 Bacteria 28997
49 Ga0466690_005517 3300042590 Bacteria 5615
50 HBC_ctgsDRAFT_1000545 3300000333 Bacteria 8380
51 Ga0466705_514418 3300042612 Bacteria 26386
52 Ga0466715_219381 3300042616 Bacteria 46408
53 Ga0466715_582189 3300042616 Bacteria 18313
54 Ga0466723_102275 3300042618 Bacteria 9131
55 Ga0466707_004458 3300042601 Bacteria 15021
56 Ga0466716_098082 3300042605 Bacteria 9599
57 Ga0466719_089595 3300042606 Unclassified 7177
58 Ga0466722_056814 3300042609 Bacteria 80468
59 Ga0466709_176307 3300042648 Bacteria 46103
60 Ga0466708_118951 3300042652 Bacteria 18039
61 Ga0466690_148568 3300042590 Bacteria 13283
62 Ga0466691_001910 3300042593 Bacteria 14434
63 Ga0466691_170023 3300042593 Bacteria 23340
64 Ga0466696_004261 3300042596 Bacteria 18622
65 Ga0466696_396464 3300042596 Bacteria 5547
66 2227158583 2225789004 Bacteria 8395
67 Ga0466711_067051 3300042615 Bacteria 5209
68 Ga0466723_090431 3300042618 Bacteria 14522
69 Ga0466707_010858 3300042601 Bacteria 10766
70 Ga0466707_228601 3300042601 Bacteria 32570
71 Ga0466713_036041 3300042602 Bacteria 5395
72 Ga0466713_047384 3300042602 Bacteria 14775
73 Ga0466713_119093 3300042602 Bacteria 59442
74 Ga0466719_418728 3300042606 Bacteria 36150
75 Ga0466735_167418 3300042624 Bacteria 4917
76 Ga0466735_194257 3300042624 Bacteria 7871
77 Ga0466704_023495 3300042643 Bacteria 52577
78 Ga0466690_022164 3300042590 Bacteria 20369
79 Ga0466692_121438 3300042591 Bacteria 29354
80 IMNBL1DRAFT_c0000101 3300000062 Bacteria 74878
81 JGI24699J35502_11134043 3300002509 Bacteria 26521
82 Ga0072941_1327505 3300005201 Bacteria 5652
83 Ga0466715_038459 3300042616 Bacteria 4844
84 Ga0466715_232894 3300042616 Bacteria 30718
85 Ga0466723_322373 3300042618 Bacteria 11767
86 Ga0466728_134519 3300042620 Bacteria 6706
87 Ga0466706_037013 3300042599 Bacteria 55068
88 Ga0466707_112015 3300042601 Bacteria 23228
89 Ga0466707_138418 3300042601 Bacteria 13284
90 Ga0466707_144970 3300042601 Bacteria 107655
91 Ga0466713_003223 3300042602 Bacteria 11508
92 Ga0466703_234712 3300042636 Bacteria 20169
93 Ga0466704_571664 3300042643 Bacteria 6398
94 Ga0466708_019276 3300042652 Bacteria 21307
95 Ga0466727_092300 3300042655 Bacteria 29838
96 Ga0466727_121354 3300042655 Bacteria 12082
97 Ga0466692_192934 3300042591 Bacteria 5946
98 Ga0466691_056156 3300042593 Bacteria 16811
99 Ga0466691_124423 3300042593 Bacteria 23661
100 Ga0466711_246639 3300042615 Bacteria 53228
101 Ga0466715_069614 3300042616 Bacteria 8086
102 Ga0466726_142521 3300042619 Bacteria 18957
103 Ga0466729_064521 3300042621 Bacteria 21158
104 Ga0466729_117371 3300042621 Bacteria 7993
105 Ga0466705_329915 3300042612 Bacteria 17803
106 Ga0466703_066889 3300042636 Bacteria 4616
107 Ga0466703_097395 3300042636 Bacteria 6949
108 Ga0466690_008835 3300042590 Bacteria 27085
109 Ga0466696_214108 3300042596 Bacteria 16171
110 Ga0466728_030268 3300042620 Bacteria 18228
111 Ga0466713_152619 3300042602 Bacteria 16856
112 Ga0466716_119960 3300042605 Bacteria 7052
113 Ga0466719_008701 3300042606 Bacteria 13516
114 Ga0466722_090408 3300042609 Bacteria 5690
115 Ga0466703_003821 3300042636 Bacteria 7568
116 Ga0466704_137650 3300042643 Bacteria 21300
117 Ga0466704_201534 3300042643 Bacteria 8199
118 IMNBL1DRAFT_c0000014 3300000062 Archaea 180092
119 Ga0466705_503724 3300042612 Bacteria 14377
120 Ga0466711_013368 3300042615 Bacteria 5277
121 Ga0466715_077430 3300042616 Bacteria 19859
122 Ga0466715_117809 3300042616 Bacteria 8696
123 Ga0466723_105098 3300042618 Bacteria 22389
124 Ga0466723_113798 3300042618 Bacteria 6033
125 Ga0466723_370758 3300042618 Bacteria 8033
126 Ga0466726_123595 3300042619 Bacteria 23616

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01493 GXGXG GXGXG motif 1306 1441 0.99
PF01645 Glu_synthase Conserved region in glutamate synthase 830 1221 0.97
PF00310 GATase_2 Glutamine amidotransferases class-II 297 457 0.95
PF04898 Glu_syn_central Glutamate synthase central domain 485 769 0.95

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01493 GO:0016491 oxidoreductase activity MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.