NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300008944

3300008944: T18 (1) (Live), Syntrophic microbial communities from an anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom ? benzoate enriched in lab, transferred 6 times DE NOVO (2)



Overview

Basic Information
IMG/M Taxon OID3300008944 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0117429 | Gp0123698 | Ga0115987
Sample NameT18 (1) (Live), Syntrophic microbial communities from an anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom ? benzoate enriched in lab, transferred 6 times DE NOVO (2)
Sequencing StatusPermanent Draft
Sequencing CenterShell Corporation
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size143481774
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica2
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSyntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment → Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater river biome → river → sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Sediment (non-saline)

Location Information
LocationUK (Newcastle upon Tyne)
CoordinatesLat. (o)54.971158Long. (o)-1.703654Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F048390Metagenome / Metatranscriptome148Y
F053838Metagenome / Metatranscriptome140Y
F089576Metagenome109Y
F101218Metagenome / Metatranscriptome102Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0115987_1014007All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica866Open in IMG/M
Ga0115987_1016309All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica786Open in IMG/M
Ga0115987_1017638Not Available747Open in IMG/M
Ga0115987_1032005Not Available506Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0115987_1014007Ga0115987_10140071F089576TMFGLPDVTIAAVGSVVVIVIIALLYWGLTFRGHD*
Ga0115987_1016309Ga0115987_10163091F053838YNSLMRYCFWSLGVPLKVGYLCALAKTTGRADFLLGVERDLPTAPAGDVSELVHLAH*
Ga0115987_1017638Ga0115987_10176381F048390SNMVRFVITLQHRVTPQGRDFYALSIPPQVAEALELKDGGQVSICVNPVKKGKFEITLKPASCDNINP*
Ga0115987_1032005Ga0115987_10320052F101218MSKQGPKPALPRVKEPPPLPSLDELIAESRALGWDDLAGSMEKLRHLETPEGQKALERREKRLSRL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.