Basic Information | |
---|---|
Taxon OID | 3300029639 Open in IMG/M |
Scaffold ID | Ga0265597_101538 Open in IMG/M |
Source Dataset Name | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36m (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 839 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Canada: Sakinaw lake, British Columbia | |||||||
Coordinates | Lat. (o) | 49.68 | Long. (o) | -124.009 | Alt. (m) | Depth (m) | 36 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F000344 | Metagenome / Metatranscriptome | 1257 | Y |
F053640 | Metagenome / Metatranscriptome | 141 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0265597_1015381 | F053640 | N/A | NSRSAAALKNVAESTAGIIPGDRGMEGDSWCCPPLQAAQAVERHISPVPLAGVVSGQFTHESGTERQGAIRIRVEPSQAHGRFRPVRRRSYPRGFWLLLRRPERSHGSRRANPAKRPHSEHEGGAQGSRDGGERADLAKSVKPPQGGGVKNHVTPLQKRKQP |
Ga0265597_1015382 | F000344 | GGA | MRPKHPHAAESGVGKHIARESERVQACATGKERVTNAHPHTLQCKAK |
⦗Top⦘ |