Basic Information | |
---|---|
Taxon OID | 3300007286 Open in IMG/M |
Scaffold ID | Ga0104348_1001251 Open in IMG/M |
Source Dataset Name | Activated sludge microbial communities from bioreactor with dissolved oxygen in CSIR-NEERI, Nagpur, India ? 1ppm of oxygen, sample A |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Xcelris labs Ltd |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3819 |
Total Scaffold Genes | 9 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 8 (88.89%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Aeration Tank Of Activated Sludge Process → Activated Sludge Process Metagenomes |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Nagpur, India | |||||||
Coordinates | Lat. (o) | 21.1458004 | Long. (o) | 79.0881546 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F051527 | Metagenome / Metatranscriptome | 144 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0104348_10012515 | F051527 | GGAG | MIKQALYALAHPVFDPERQITGKHYWQADRDVTACLTVNIGME* |
⦗Top⦘ |