NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300007286

3300007286: Activated sludge microbial communities from bioreactor with dissolved oxygen in CSIR-NEERI, Nagpur, India ? 1ppm of oxygen, sample A



Overview

Basic Information
IMG/M Taxon OID3300007286 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0118053 | Gp0127442 | Ga0104348
Sample NameActivated sludge microbial communities from bioreactor with dissolved oxygen in CSIR-NEERI, Nagpur, India ? 1ppm of oxygen, sample A
Sequencing StatusPermanent Draft
Sequencing CenterXcelris labs Ltd
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size96235532
Sequencing Scaffolds7
Novel Protein Genes7
Associated Families7

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Bacteria → PVC group1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea → Miltoncostaea oceani1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameActivated Sludge Process Metagenomes
TypeEngineered
TaxonomyEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Aeration Tank Of Activated Sludge Process → Activated Sludge Process Metagenomes

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationNagpur, India
CoordinatesLat. (o)21.1458004Long. (o)79.0881546Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000676Metagenome / Metatranscriptome941Y
F002401Metagenome / Metatranscriptome563Y
F003296Metagenome / Metatranscriptome495Y
F020980Metagenome / Metatranscriptome221Y
F051527Metagenome / Metatranscriptome144Y
F091594Metagenome / Metatranscriptome107Y
F103798Metagenome101Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0104348_1001251All Organisms → cellular organisms → Bacteria3819Open in IMG/M
Ga0104348_1002921All Organisms → cellular organisms → Bacteria → PVC group2032Open in IMG/M
Ga0104348_1018245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea → Miltoncostaea oceani1646Open in IMG/M
Ga0104348_1032013All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria966Open in IMG/M
Ga0104348_1061557All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria520Open in IMG/M
Ga0104348_1102834All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria571Open in IMG/M
Ga0104348_1136333Not Available687Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0104348_1001251Ga0104348_10012515F051527MIKQALYALAHPVFDPERQITGKHYWQADRDVTACLTVNIGME*
Ga0104348_1002921Ga0104348_10029211F020980VGNVLVALFAILLCLVNAVVWTFVSEMPIAGVGWVIAAAFCFYLQKWSQG*
Ga0104348_1018245Ga0104348_10182451F103798VTPPPEIDTEEQQLALVSQDHLRSLHQPLKYGFADRSTARKGLEVAAGVAIADRLGSIRQTAGPPIGRHGYMAIVWLGSRWLQLEQSTATAIPFSQYRMLHDFGWHESGRNARQALKRTLLNLQEARWEGDVNDSVTGRKTHEDHFGIIDRVLWPVVNDGRTERAGYIFLGSWFLEQLRHEAGAYIDWDVLRDLPPIARKLYGLLENDRFDPGERGEEWQSYWLGDPFFASVGSTCARERDNVAAVARACEA
Ga0104348_1032013Ga0104348_10320131F000676LPARRRRHPGTPCAAIGDGGGARGLGLQPRRIAAGLADLRRDPRIACKVSARVRIGLARICRELAAKDAADAAHEAGGAEQIEVYAVADTPRGKRPAPDEHDSLVASLASFSDPMWQVKDRSVAGLRIAASGGIGQSLALGGLVAVRQSDVSDFVLGVVRRLNKVSNEEVEAGVSIIAERFVPVTLHTRREPRGDLGFVVNGIEVATIGSRFDALYLPPPSRPDKPLAVKTLIVPTSEYSEGRSVILMTGRSIYTVAMRALVEQRAEWSWTTIQILEKKARV*
Ga0104348_1061557Ga0104348_10615572F003296PTGAEREALAEEIRMQVLQRIDMFTDAGLRERLGERLKPIVDRASADLVDAINQHVGEILRAYVAEAIEREIDRWRSGRA*
Ga0104348_1102834Ga0104348_11028342F002401APKLDPATFPQGAIYVCASGAAPQRTITAIAFDEKAGKLCRRHPEMGPCQYERNLCRRSGGRVYAADGTEITMATEAEYDRKVMRVRFQAK*
Ga0104348_1136333Ga0104348_11363331F091594MSENGITHYCLGNGEPKCDGCKQEKNWQTLNQMPDTLRKSLQAQAQRIDDTDCILSG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.