NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0077107_108248

Scaffold Ga0077107_108248


Overview

Basic Information
Taxon OID3300005627 Open in IMG/M
Scaffold IDGa0077107_108248 Open in IMG/M
Source Dataset NameCrenothrix polyspora biofilm communities from Wolfenbuettel waterworks, Germany
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)824
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Crenothrix Polyspora → Crenothrix Polyspora Biofilm Communities From Wolfenbuettel Waterworks, Germany

Source Dataset Sampling Location
Location NameGermany: Wolfenb?ttel, Lower Saxony
CoordinatesLat. (o)52.149Long. (o)10.542Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018543Metagenome / Metatranscriptome234Y

Sequences

Protein IDFamilyRBSSequence
Ga0077107_1082483F018543AGGAMIETWSNQSAAANRRPAGQADGSDNLSAIVAADRAFPAAVAELGR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.