NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold MIS_10007163

Scaffold MIS_10007163


Overview

Basic Information
Taxon OID3300002026 Open in IMG/M
Scaffold IDMIS_10007163 Open in IMG/M
Source Dataset NameSinkhole freshwater microbial communities from Lake Huron, USA - Flux 5k+
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Michigan
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)12083
Total Scaffold Genes21 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)19 (90.48%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater → Sinkhole Freshwater Microbial Communities From Lake Huron, Us

Source Dataset Sampling Location
Location NameMiddle Island Sinkhole, Lake Huron Michigan, USA
CoordinatesLat. (o)45.19843Long. (o)-83.32721Alt. (m)Depth (m)23
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F058545Metagenome / Metatranscriptome135Y
F059119Metagenome / Metatranscriptome134Y
F064355Metagenome / Metatranscriptome128Y

Sequences

Protein IDFamilyRBSSequence
MIS_1000716310F059119AGCAGGMLEFIILVLTAQLLLSFFGQSIFPGVPHTGSFIYILSVLIVVLIMMKFLMLSM*
MIS_100071632F058545AGGAMKMKNVFAAASAGMILLLLAACNMPKPASAPMPTPTEVVMPATGVEYTFVTNKLLMPTTQEQTQEFALNVDGDTQNTTDNKFGTLLTLLTSAVRNIELQSTLDQAVDNGQLVSLHVIKADDALNDTSVSWSILQGQQTLTAPSFDGSDKFALDAVAPANLPIVGSLTNGHFSGGPGAAKVQMVLLGQPLTVDLIGMRLEVDVSAKGCVNGKLGGAVTVEEFSGKILPPIAEGLNLVIRSDATAATAILQAFDADGNGAITSQELENNPLLMIAVSPDVDMLDASGNFNPRQDGVNDSYSVGLGFTCVPATWELALVP*
MIS_100071639F064355AGGAMSMKNIFSIFNSKFLTHLRQLFTNEYPDSKSEVEKRKVAVENNLRWQDDGGPVVENTRPVEQAAENDPADPGGTAGNDHEKRR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.