NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F099975

Metagenome / Metatranscriptome Family F099975

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F099975
Family Type Metagenome / Metatranscriptome
Number of Sequences 103
Average Sequence Length 40 residues
Representative Sequence LRKVKEIKGLRGDVLEYVAQGIPQIDAEIAEKGHLWMETS
Number of Associated Samples 85
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 36.00 %
% of genes near scaffold ends (potentially truncated) 68.93 %
% of genes from short scaffolds (< 2000 bps) 81.55 %
Associated GOLD sequencing projects 82
AlphaFold2 3D model prediction Yes
3D model pTM-score0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (78.641 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands
(18.447 % of family members)
Environment Ontology (ENVO) Unclassified
(33.010 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(33.010 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 55.88%    β-sheet: 0.00%    Coil/Unstructured: 44.12%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF03625DUF302 3.88
PF00072Response_reg 1.94
PF00756Esterase 1.94
PF13458Peripla_BP_6 1.94
PF00196GerE 1.94
PF13535ATP-grasp_4 1.94
PF11306DUF3108 1.94
PF00361Proton_antipo_M 1.94
PF09957VapB_antitoxin 0.97
PF01790LGT 0.97
PF00989PAS 0.97
PF00343Phosphorylase 0.97
PF07729FCD 0.97
PF00795CN_hydrolase 0.97
PF13432TPR_16 0.97
PF00293NUDIX 0.97
PF00581Rhodanese 0.97
PF00583Acetyltransf_1 0.97
PF05222AlaDh_PNT_N 0.97
PF02545Maf 0.97
PF05598DUF772 0.97
PF00155Aminotran_1_2 0.97
PF00696AA_kinase 0.97
PF01209Ubie_methyltran 0.97
PF02441Flavoprotein 0.97
PF02655ATP-grasp_3 0.97
PF01656CbiA 0.97
PF07992Pyr_redox_2 0.97
PF13247Fer4_11 0.97
PF01609DDE_Tnp_1 0.97
PF00221Lyase_aromatic 0.97
PF13518HTH_28 0.97
PF10531SLBB 0.97
PF02954HTH_8 0.97
PF00872Transposase_mut 0.97
PF03692CxxCxxCC 0.97
PF10082BBP2_2 0.97
PF11075DUF2780 0.97
PF00528BPD_transp_1 0.97
PF02272DHHA1 0.97
PF03548LolA 0.97
PF00664ABC_membrane 0.97
PF01312Bac_export_2 0.97
PF00004AAA 0.97
PF01808AICARFT_IMPCHas 0.97
PF01551Peptidase_M23 0.97
PF13428TPR_14 0.97
PF14535AMP-binding_C_2 0.97
PF07589PEP-CTERM 0.97
PF00406ADK 0.97
PF01171ATP_bind_3 0.97
PF13899Thioredoxin_7 0.97
PF08402TOBE_2 0.97
PF13242Hydrolase_like 0.97
PF03602Cons_hypoth95 0.97
PF12766Pyridox_oxase_2 0.97
PF02518HATPase_c 0.97
PF13932GIDA_C 0.97
PF01411tRNA-synt_2c 0.97
PF13437HlyD_3 0.97
PF07963N_methyl 0.97
PF00132Hexapep 0.97
PF08149BING4CT 0.97
PF04165DUF401 0.97
PF03734YkuD 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG3439Uncharacterized conserved protein, DUF302 familyFunction unknown [S] 3.88
COG0013Alanyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.97
COG0037tRNA(Ile)-lysidine synthase TilS/MesJTranslation, ribosomal structure and biogenesis [J] 0.97
COG0058Glucan phosphorylaseCarbohydrate transport and metabolism [G] 0.97
COG0138AICAR transformylase/IMP cyclohydrolase PurHNucleotide transport and metabolism [F] 0.97
COG0301Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis)Translation, ribosomal structure and biogenesis [J] 0.97
COG04247-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamilySecondary metabolites biosynthesis, transport and catabolism [Q] 0.97
COG0482tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domainTranslation, ribosomal structure and biogenesis [J] 0.97
COG0519GMP synthase, PP-ATPase domain/subunitNucleotide transport and metabolism [F] 0.97
COG0563Adenylate kinase or related kinaseNucleotide transport and metabolism [F] 0.97
COG06037-cyano-7-deazaguanine synthase (queuosine biosynthesis)Translation, ribosomal structure and biogenesis [J] 0.97
COG0682Prolipoprotein diacylglyceryltransferaseCell wall/membrane/envelope biogenesis [M] 0.97
COG074216S rRNA G966 N2-methylase RsmDTranslation, ribosomal structure and biogenesis [J] 0.97
COG109223S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmITranslation, ribosomal structure and biogenesis [J] 0.97
COG1376Lipoprotein-anchoring transpeptidase ErfK/SrfKCell wall/membrane/envelope biogenesis [M] 0.97
COG1606ATP-utilizing enzyme, PP-loop superfamilyGeneral function prediction only [R] 0.97
COG1802DNA-binding transcriptional regulator, GntR familyTranscription [K] 0.97
COG1906Predicted GntP-related membrane permease AF0261, DUF401 familyGeneral function prediction only [R] 0.97
COG2186DNA-binding transcriptional regulator, FadR familyTranscription [K] 0.97
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 0.97
COG22272-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylaseCoenzyme transport and metabolism [H] 0.97
COG2242Precorrin-6B methylase 2Coenzyme transport and metabolism [H] 0.97
COG2265tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD familyTranslation, ribosomal structure and biogenesis [J] 0.97
COG2834Outer membrane lipoprotein-sorting proteinCell wall/membrane/envelope biogenesis [M] 0.97
COG2890Methylase of polypeptide chain release factorsTranslation, ribosomal structure and biogenesis [J] 0.97
COG2986Histidine ammonia-lyaseAmino acid transport and metabolism [E] 0.97
COG3034Murein L,D-transpeptidase YafKCell wall/membrane/envelope biogenesis [M] 0.97
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.97
COG3293TransposaseMobilome: prophages, transposons [X] 0.97
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 0.97
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.97
COG5421TransposaseMobilome: prophages, transposons [X] 0.97
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.97
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.97

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms80.58 %
UnclassifiedrootN/A19.42 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001533|MLSed_10007624All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria8786Open in IMG/M
3300001533|MLSed_10169654All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales897Open in IMG/M
3300001533|MLSed_10324759Not Available539Open in IMG/M
3300001854|JGI24422J19971_10164808All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1014Open in IMG/M
3300001855|JGI2160J19893_10105656All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria546Open in IMG/M
3300002231|KVRMV2_101553678All Organisms → cellular organisms → Archaea712Open in IMG/M
3300003541|JGI20214J51650_10115023All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae1839Open in IMG/M
3300003991|Ga0055461_10141226All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria629Open in IMG/M
3300004004|Ga0055451_10107934All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae1109Open in IMG/M
3300004008|Ga0055446_10238621All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae551Open in IMG/M
3300004014|Ga0055456_10282898All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria586Open in IMG/M
3300004024|Ga0055436_10170067All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria672Open in IMG/M
3300004028|Ga0055447_10081780All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae900Open in IMG/M
3300004029|Ga0055442_10142962All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria753Open in IMG/M
3300004063|Ga0055483_10100571All Organisms → cellular organisms → Bacteria → Proteobacteria896Open in IMG/M
3300004071|Ga0055486_10103040Not Available650Open in IMG/M
3300004146|Ga0055495_10067828Not Available784Open in IMG/M
3300004459|Ga0065201_1611709All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium648Open in IMG/M
3300005182|Ga0069000_10066642All Organisms → cellular organisms → Bacteria → Proteobacteria843Open in IMG/M
3300005215|Ga0069001_10004834All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → unclassified Desulfosarcina → Desulfosarcina sp.2165Open in IMG/M
3300005216|Ga0068994_10020144All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae1347Open in IMG/M
3300005252|Ga0068712_1020629All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfosudaceae → Desulfosudis → Desulfosudis oleivorans3505Open in IMG/M
3300005254|Ga0068714_10329815All Organisms → cellular organisms → Bacteria → Proteobacteria588Open in IMG/M
3300005264|Ga0073581_101831All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina14029Open in IMG/M
3300005820|Ga0078747_135051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia farcinica1128Open in IMG/M
3300005822|Ga0078744_1090173All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria712Open in IMG/M
3300005832|Ga0074469_10333859All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria11745Open in IMG/M
3300006930|Ga0079303_10231883All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria747Open in IMG/M
3300007764|Ga0102950_1294437All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300007764|Ga0102950_1298766Not Available505Open in IMG/M
3300007784|Ga0102955_1001533All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria4829Open in IMG/M
3300008627|Ga0115656_1195948Not Available763Open in IMG/M
3300009008|Ga0115649_1212771All Organisms → cellular organisms → Bacteria1410Open in IMG/M
3300009009|Ga0105105_10521469Not Available682Open in IMG/M
3300009078|Ga0105106_10139854Not Available1779Open in IMG/M
3300009127|Ga0118724_1015625All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS27854Open in IMG/M
3300009129|Ga0118728_1173850All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium920Open in IMG/M
3300009145|Ga0102961_1016618All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium1554Open in IMG/M
3300009153|Ga0105094_10670622All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium606Open in IMG/M
3300009431|Ga0120401_1010513All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae17753Open in IMG/M
3300009431|Ga0120401_1023989All Organisms → cellular organisms → Bacteria9233Open in IMG/M
3300009506|Ga0118657_10612571All Organisms → cellular organisms → Bacteria1388Open in IMG/M
3300009506|Ga0118657_10669244All Organisms → cellular organisms → Bacteria1314Open in IMG/M
3300009506|Ga0118657_11572484All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium S5133MH16774Open in IMG/M
3300009506|Ga0118657_11584345All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria770Open in IMG/M
3300009509|Ga0123573_10395393All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia farcinica1326Open in IMG/M
3300009509|Ga0123573_10398376All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1320Open in IMG/M
3300009509|Ga0123573_10635684All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Sediminispirochaeta1007Open in IMG/M
3300009509|Ga0123573_11373917All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300009513|Ga0129285_10612943All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium SEEP-SAG10509Open in IMG/M
3300009528|Ga0114920_10212264All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1289Open in IMG/M
3300009529|Ga0114919_10131912All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae1804Open in IMG/M
3300009529|Ga0114919_10855288All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium C00003093615Open in IMG/M
3300009874|Ga0131789_10186489All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300010413|Ga0136851_10303775All Organisms → cellular organisms → Bacteria1619Open in IMG/M
3300010430|Ga0118733_102638126All Organisms → cellular organisms → Bacteria992Open in IMG/M
3300011118|Ga0114922_11659708All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300011262|Ga0151668_1324373Not Available762Open in IMG/M
3300014295|Ga0075305_1030222All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria944Open in IMG/M
3300014307|Ga0075304_1064882All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria794Open in IMG/M
3300017991|Ga0180434_10618765All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium825Open in IMG/M
3300019733|Ga0194013_1008840All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria957Open in IMG/M
3300022218|Ga0224502_10369567Not Available555Open in IMG/M
(restricted) 3300022938|Ga0233409_10033469Not Available1431Open in IMG/M
(restricted) 3300022938|Ga0233409_10085977Not Available976Open in IMG/M
(restricted) 3300022938|Ga0233409_10103774All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium901Open in IMG/M
(restricted) 3300022938|Ga0233409_10165051Not Available735Open in IMG/M
(restricted) 3300023089|Ga0233408_10129469Not Available560Open in IMG/M
3300025554|Ga0210060_1042543Not Available758Open in IMG/M
3300025557|Ga0210141_1032591All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria998Open in IMG/M
3300025565|Ga0210110_1030747All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1354Open in IMG/M
3300025568|Ga0210095_1004878All Organisms → cellular organisms → Bacteria2858Open in IMG/M
3300025573|Ga0210133_1024985Not Available1275Open in IMG/M
3300025969|Ga0210080_1002576All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2196Open in IMG/M
3300026099|Ga0209920_1004101All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatitalea → Desulfatitalea tepidiphila1862Open in IMG/M
3300026138|Ga0209951_1067000All Organisms → cellular organisms → Bacteria → Proteobacteria756Open in IMG/M
3300026534|Ga0256841_1007272All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria7304Open in IMG/M
3300027790|Ga0209273_10416076All Organisms → cellular organisms → Bacteria → Proteobacteria532Open in IMG/M
3300027792|Ga0209287_10116208All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacterium → environmental samples → uncultured Desulfobacterium sp.1006Open in IMG/M
3300027888|Ga0209635_10846270All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria650Open in IMG/M
3300027917|Ga0209536_102151892All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Desulfuromonadaceae → Desulfuromonas → unclassified Desulfuromonas → Desulfuromonas sp. SDB666Open in IMG/M
3300031276|Ga0307441_1124647All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia vada756Open in IMG/M
3300031277|Ga0307425_1207245All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → unclassified Nitrospira → Nitrospira bacterium SG8_3593Open in IMG/M
3300031341|Ga0307418_1087841All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium814Open in IMG/M
3300031341|Ga0307418_1097867All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria763Open in IMG/M
3300031354|Ga0307446_1039564All Organisms → cellular organisms → Bacteria1388Open in IMG/M
3300031367|Ga0307440_1059602All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1137Open in IMG/M
3300031371|Ga0307423_1065028All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae1162Open in IMG/M
3300031691|Ga0316579_10258072Not Available843Open in IMG/M
3300031727|Ga0316576_10013950All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini5357Open in IMG/M
3300031727|Ga0316576_10982321All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium602Open in IMG/M
3300031733|Ga0316577_10237839All Organisms → cellular organisms → Bacteria1030Open in IMG/M
3300032061|Ga0315540_10053712All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria1921Open in IMG/M
3300032133|Ga0316583_10001960All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini7029Open in IMG/M
3300032163|Ga0315281_12280922All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria511Open in IMG/M
3300032251|Ga0316198_10001524All Organisms → cellular organisms → Bacteria → Proteobacteria13653Open in IMG/M
3300032252|Ga0316196_10232289All Organisms → cellular organisms → Bacteria → Proteobacteria814Open in IMG/M
3300032258|Ga0316191_10524618All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium862Open in IMG/M
3300032276|Ga0316188_10025248All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2801Open in IMG/M
3300033541|Ga0316596_1190923Not Available568Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands18.45%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine7.77%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh6.80%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment5.83%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere5.83%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater4.85%
Mangrove SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment4.85%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.85%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment3.88%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment3.88%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface3.88%
Mangrove SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment3.88%
BenthicEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Benthic2.91%
SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Sediment1.94%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow1.94%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.94%
Enrichment CultureEngineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture1.94%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.97%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.97%
Salt Marsh SedimentEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment0.97%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.97%
SedimentEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Sediment0.97%
Hydrothermal VentsEnvironmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents0.97%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment0.97%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.97%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.97%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment0.97%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.97%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.97%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.97%
Beach Aquifer PorewaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater0.97%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.97%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001533Benthic freshwater microbial communities from British Columbia, CanadaEnvironmentalOpen in IMG/M
3300001854Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-52-54EnvironmentalOpen in IMG/M
3300001855Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12EnvironmentalOpen in IMG/M
3300002231Marine sediment microbial communities from Santorini caldera mats, Greece - red matEnvironmentalOpen in IMG/M
3300003541Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 BulkEnvironmentalOpen in IMG/M
3300003991Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300004004Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D2EnvironmentalOpen in IMG/M
3300004008Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordB_D2EnvironmentalOpen in IMG/M
3300004014Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D2EnvironmentalOpen in IMG/M
3300004024Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2EnvironmentalOpen in IMG/M
3300004028Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordC_D2EnvironmentalOpen in IMG/M
3300004029Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordB_D2EnvironmentalOpen in IMG/M
3300004063Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLB_D2EnvironmentalOpen in IMG/M
3300004071Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D2EnvironmentalOpen in IMG/M
3300004146Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D2EnvironmentalOpen in IMG/M
3300004459Marine microbial communities from Galveston Bay (MSEDA12C- fraction 11)EnvironmentalOpen in IMG/M
3300005182Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordA_D2EnvironmentalOpen in IMG/M
3300005215Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordB_D2EnvironmentalOpen in IMG/M
3300005216Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLA_D2EnvironmentalOpen in IMG/M
3300005252Enrichment culture microbial communities from Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKS1 (Arthur Kill Sulfidogenic replicate 1) MetaGEngineeredOpen in IMG/M
3300005254Enrichment culture microbial communities from rom New York Harbor, USA that are MTBE-degrading - MTBE-NYH (New York Harbor Sulfidogenic) MetaGEngineeredOpen in IMG/M
3300005264Hydrothermal sediment microbial communities from Guaymas Basin, California, USA 4572. Combined assembly of Gp0115316 and Gp0146562EnvironmentalOpen in IMG/M
3300005820Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 75 cmbsf, PM2EnvironmentalOpen in IMG/M
3300005822Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf, MM1EnvironmentalOpen in IMG/M
3300005832Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBBEnvironmentalOpen in IMG/M
3300006930Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWCEnvironmentalOpen in IMG/M
3300007764Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_D2_MGEnvironmentalOpen in IMG/M
3300007784Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D1_MGEnvironmentalOpen in IMG/M
3300008627Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 247m, 2.7-0.2umEnvironmentalOpen in IMG/M
3300009008Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 250-2.7umEnvironmentalOpen in IMG/M
3300009009Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009107Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 295m, 2.7-0.2um, replicate bEnvironmentalOpen in IMG/M
3300009127Combined Assembly of Gp0137036, Gp0137038EnvironmentalOpen in IMG/M
3300009129Combined Assembly of Gp0139513, Gp0139514EnvironmentalOpen in IMG/M
3300009145Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_D1_MGEnvironmentalOpen in IMG/M
3300009153Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009431Combined Assembly of Gp0137033, Gp0137034EnvironmentalOpen in IMG/M
3300009506Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8EnvironmentalOpen in IMG/M
3300009509Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11EnvironmentalOpen in IMG/M
3300009513Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - F-1YEnvironmentalOpen in IMG/M
3300009528Deep subsurface microbial communities from South Pacific Ocean to uncover new lineages of life (NeLLi) - Chile_00310 metaGEnvironmentalOpen in IMG/M
3300009529Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaGEnvironmentalOpen in IMG/M
3300009874Sea floor sediment microbial communities from Gulf of Mexico Methane Seep - MPC1TEnvironmentalOpen in IMG/M
3300010413Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9EnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300011118Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaGEnvironmentalOpen in IMG/M
3300011262Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_5, totalEnvironmentalOpen in IMG/M
3300014295Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D1EnvironmentalOpen in IMG/M
3300014307Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D1EnvironmentalOpen in IMG/M
3300017991Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_2 metaGEnvironmentalOpen in IMG/M
3300019733Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_9-10_MGEnvironmentalOpen in IMG/M
3300022218Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13EnvironmentalOpen in IMG/M
3300022938 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_13_MGEnvironmentalOpen in IMG/M
3300023089 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_11_MGEnvironmentalOpen in IMG/M
3300025554Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025557Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025565Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025568Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025573Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025969Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_CordB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026099Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_D1_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026138Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026534Hydrothermal vent microbial communities from Mid Atlantic Ridge, Atlantic Ocean - 356-308EnvironmentalOpen in IMG/M
3300027790Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 (SPAdes)EnvironmentalOpen in IMG/M
3300027792Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027888Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes)EnvironmentalOpen in IMG/M
3300027917Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)EnvironmentalOpen in IMG/M
3300031276Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-20EnvironmentalOpen in IMG/M
3300031277Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-30EnvironmentalOpen in IMG/M
3300031341Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1602-20EnvironmentalOpen in IMG/M
3300031354Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - SW1603-20EnvironmentalOpen in IMG/M
3300031367Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-10EnvironmentalOpen in IMG/M
3300031371Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-10EnvironmentalOpen in IMG/M
3300031691Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrAHost-AssociatedOpen in IMG/M
3300031727Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5Host-AssociatedOpen in IMG/M
3300031733Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1Host-AssociatedOpen in IMG/M
3300032061Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-10EnvironmentalOpen in IMG/M
3300032133Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrAHost-AssociatedOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032251Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A anoxicEnvironmentalOpen in IMG/M
3300032252Coastal sediment microbial communities from Maine, United States - Eddy sediment 2 cmEnvironmentalOpen in IMG/M
3300032258Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 cmEnvironmentalOpen in IMG/M
3300032276Coastal sediment microbial communities from Maine, United States - Phippsburg worm burrow 1EnvironmentalOpen in IMG/M
3300033541Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
MLSed_10007624153300001533BenthicMDGPSQIKGLRGGVLEYAAQGIPQIDEEIAENGHFWMETS*
MLSed_1016965413300001533BenthicQIKGLRGGVLEYAAQGIPQIDAEIAENSHFRIETS*
MLSed_1032475913300001533BenthicRARAMDGPSQIKGLRGGVLEYAAQGIPQIDAELAENSHFWMETS*
JGI24422J19971_1016480823300001854Marine SedimentMHAPSQFKGLRGGVHRYVAQAIPQIDAEIAEKGHFWMETS*
JGI2160J19893_1010565623300001855Marine SedimentLRKVKEFKGLRGDVLKYVAQEIPQIDAEIPQNGHLWMEAS*
KVRMV2_10155367813300002231Marine SedimentIKGLRGGVACYAAQAIPQIDAEIGEIDHLWMETS*
JGI20214J51650_1011502313300003541WetlandLPKVKETKLLRGGILGYAAQAIAQVDAEIGQKGHLWMETN*
Ga0055461_1014122613300003991Natural And Restored WetlandsLRKIKEIKGLRGDVLQYVAQGIPLIDAEMAGKSHLWMKTN*
Ga0055451_1010793423300004004Natural And Restored WetlandsMQKLAIFRKVKKIKKLRGGVQMVHAQVIPQIDEEIAEKGPFWMETNSG*
Ga0055446_1023862113300004008Natural And Restored WetlandsLRKVKESKEWRGGILPYAAQAIPLLDAEIAQKGHFWMETSV*
Ga0055456_1028289823300004014Natural And Restored WetlandsLKVKEIKELRGGVLLYAAQAIPQIDAEIEQKGHLWMETI*
Ga0055436_1017006723300004024Natural And Restored WetlandsMSNFRKIKEIKELCGGVQIDAAQVIPQIDAEIAKKGYFWMETSWPLGLW
Ga0055447_1008178013300004028Natural And Restored WetlandsLLTAKAIKELRGGLLLYAAQAIPQIDAEIGQKGHLWIDHS*
Ga0055442_1014296223300004029Natural And Restored WetlandsCKVKENKGLCGGVPRYVAQVTPQFDAEIAEKGHLWMETS*
Ga0055483_1010057123300004063Natural And Restored WetlandsRKIKEVKGLRGDVLWYVAQASTQIDAEIGEKGRLWMETS*
Ga0055486_1010304013300004071Natural And Restored WetlandsMSSFLQFKEIKEWRGGVLVYVAQAIPPIDAEIAEKGHLWT
Ga0055495_1006782823300004146Natural And Restored WetlandsMSSFLQVKEIKEWRGGVLVYVAQAIPPIDAEIAEKGHLWT
Ga0065201_161170913300004459SedimentFFCKIKKSKGLRGDVREYLAQMIPQADVEMVKKSHLWMETR*
Ga0069000_1006664213300005182Natural And Restored WetlandsVPGFRKVKKIKGLRGGVLMYAAQEIPLIDAEIPEKGHLWMETN*
Ga0069001_1000483433300005215Natural And Restored WetlandsMQKLAIFRNVKAIKELRVPPSGEQVISQINAEIAEKGNFWMETN
Ga0068994_1002014423300005216Natural And Restored WetlandsLLKVKEIKELRGRTQLYAAQPILKIDTEIGQKVAFFKGI*
Ga0068712_102062953300005252Enrichment CultureFRKVKENKGMCGDVLDVVAQAAPQFDTEIAGKGHLRMETV*
Ga0068714_1032981523300005254Enrichment CultureVKEIKGLRGAYNRYAAQGIPQIDAEIAEKGHFWMETRQAL*
Ga0073581_101831183300005264SedimentMSNFSQGKEIKELRGGVQVDAAQVIPQIDAEIAEKGHFWMHTN*
Ga0078747_13505123300005820Marine SedimentMETPSQIKGLRGGVHAYAAQAIPKIDAEIAEKGHFWMETI*
Ga0078744_102469923300005822Marine SedimentSVSFQFRNEQFCKVKENKGLRGGVPGYVAQATPHFDAEIAEKGHLWMETS*
Ga0078744_109017313300005822Marine SedimentVKENKGLRGGVPRYVAQATPQFDAEIAKKGHLWMETV*
Ga0074469_1033385953300005832Sediment (Intertidal)LFKVKEIKELRGGVLLYAAQAIPQIDAEIGEKGHLWMETNYAY*
Ga0079303_1023188323300006930Deep SubsurfaceMSNFCKIKEIKELRGGVQIDAAQVIPQINAEIAEKGHFWMETS*
Ga0102950_129443713300007764SoilKKNKGLRGGVRKYVAQGTPQFDAEIAEKGHLWMETSIKFH*
Ga0102950_129876623300007764SoilMIFSKFKEIKGLRGDVLKYIAQVILQIDAEIVKKGRLWMET
Ga0102955_100153363300007784SoilLFKIKEIKELRGGLLFYAAQAIPQIDAEIGQKGHLWMETNYAY*
Ga0115656_119594813300008627MarineIKLLRGDVACYVAQARAPIDAELGQKDHSWMEPN*
Ga0115649_121277133300009008MarineYKFKEIKELRGGVLKYAAQAIPRIDAEIVKKGHFWMETN*
Ga0105105_1052146913300009009Freshwater SedimentNEELRGDVPRYVAQATPQFDADIAEKSHLWMETK*
Ga0105106_1013985423300009078Freshwater SedimentPSQNEGLRGDVPRYVAQATPQFDAKIAEKGHLWM*
Ga0117918_13589723300009107MarineEIKLLRGDVACYVAQARAPIDAEIGQKDHSWMETI*
Ga0118724_101562583300009127MarineFRKVKKIKELRGGVHIVRRQVIPQIPAEIAEKGHFWMETN*
Ga0118728_117385013300009129MarineLRKTKEIKGLRGDALMCVAQAIPQIDAEFAKKDHFGME
Ga0102961_101661833300009145SoilLFKVKEIKELRVPSFGREQAIPQIDAEIGEKGHLWMETNYAY*
Ga0105094_1067062223300009153Freshwater SedimentMDAPSQNEELRGGVPRYAAQATPEFDAEIAEKGHLWME
Ga0120401_101051313300009431MarineFVKIKEIKGLRGDVACHVAQAIPKIDAEIGEIDHLWMETD*
Ga0120401_102398913300009431MarineYKFKEIKELRGGVLKYAAQAIPRIDAEIVKKGRLWMETS*
Ga0118657_1061257123300009506Mangrove SedimentLRKIKEIKGLRGDVLQYVAQGILMIDAEIAGKSHLWIKIN*
Ga0118657_1066924413300009506Mangrove SedimentMDAPSQIKGLRGGVLNYAAREILQIDTEIAEKGHLWMETNWGI
Ga0118657_1157248423300009506Mangrove SedimentLQKLAIIRKIKEIKELRGGVPNGTPAQGIPQIDAEIAQKDHLWIDTN*
Ga0118657_1158434523300009506Mangrove SedimentLRGTVLKYAAQKIPQIDAEIAQKGYLWMETGQLGQT
Ga0123573_1039539323300009509Mangrove SedimentEIKGLRGGVLKYAAQEIPQIDTEIAEKGHLWMETSEMAHYWK*
Ga0123573_1039837623300009509Mangrove SedimentVKENKGLRGDVRSHVAQGTPQFDTEIAEKGHLWMETR*
Ga0123573_1063568413300009509Mangrove SedimentMDGPSQIKGLRGGVLNYATQEIPQIDTEIAEKGHFRMKTNQLCPIP
Ga0123573_1137391723300009509Mangrove SedimentMDAPCQIKWLRGGALEYAAQEIPQIDTEIAEKGHLWMETN*
Ga0129285_1061294323300009513Beach Aquifer PorewaterEIKGLRGGTHWYVAQTIPQSDAEIAEKGHFWMETS*
Ga0114920_1021226423300009528Deep SubsurfaceARARGMDAPSQIKGLRGGVHWYAAQAITQIDAEIAKKGHFWMETD*
Ga0114919_1013191213300009529Deep SubsurfaceLKGLRGDVRRYVAQAIQQIDAEIAKKGHFWMETSYNPYD*
Ga0114919_1085528823300009529Deep SubsurfaceFRKVKEIKGLRGDVRRYVAQAIPQIDAEIAKNGHFWMETN*
Ga0131789_1018648913300009874SedimentVIFREVKEIRGLRGDVLMYAIQTILQIDAEIAEKGHFW
Ga0136851_1030377513300010413Mangrove SedimentSFRKVKQIQGLRGGVLPYAAQEIPQIDTEITEKGHLWMQTSAQ*
Ga0118733_10245915813300010430Marine SedimentVKEIKLLRGDVACYVAQARAPIDAEIGQKDHSWMENR*
Ga0118733_10263812633300010430Marine SedimentRKLQEIKGLRGDVLGYVAQGNPKIDTKIAEKRHFRTETI*
Ga0114922_1165970813300011118Deep SubsurfaceMIFYKFKEIKELRGGLQLYAAQTISKIDAEIVKKGHFWMETN*
Ga0151668_132437323300011262MarineIKEIKGLRGDVACYVAQANPQIDAEIAEKGHLWMETR*
Ga0075305_103022213300014295Natural And Restored WetlandsGGILLYAAQAIPPIDAEIAEKGRLWLETNLFYREP*
Ga0075304_106488223300014307Natural And Restored WetlandsAALRGGILLYAAQAIPPIDAEIAEKGNLWTETSLVS*
Ga0180434_1061876513300017991Hypersaline Lake SedimentKIKGLRGGVPRYVAQAIPQIDAEIAEKGHLWMETS
Ga0194013_100884023300019733SedimentLFKVKEIKELPGGLLFYAAQAIPQIDAEIGQKGHLWMETNYAY
Ga0224502_1036956713300022218SedimentKVKEIKGLRGGVLLRYVAQEIPLIDTEIVARAHLWTETSEW
(restricted) Ga0233409_1003346923300022938SeawaterKENKGMRGGVPRYVAQAIPQFDAEIAEKGHLWMETIYFSP
(restricted) Ga0233409_1008597723300022938SeawaterVKGNKGLRGGVPRYVAQATPQFDAEIAEKGHLWMETNWEQLIWTISA
(restricted) Ga0233409_1010377423300022938SeawaterKENKGMRGGVPRYVAQATPQFDAKIAEKGHLWMETS
(restricted) Ga0233409_1016505113300022938SeawaterNKELRGGVPRYVAQTTPQFDAEIAEKGHLWMETISC
(restricted) Ga0233408_1012946923300023089SeawaterVRGGVPRYVAQAKPQFDAEIAEKGHLWMETNLHFAKILCTP
Ga0210060_104254323300025554Natural And Restored WetlandsLRKIKEIKGLRGDVLQYVAQGIPLIDAEMAGKSHLWMKTN
Ga0210141_103259113300025557Natural And Restored WetlandsLLKVKEIKELRGGVLLYAAQAIPQIDAEIGQKGHLWMETS
Ga0210110_103074713300025565Natural And Restored WetlandsLRGGVLLYVAQAIPPIDAEIAEKGHLWTETNLNPPCL
Ga0210095_100487823300025568Natural And Restored WetlandsVALRGGVLLYAAQAIPPIDAEIAGKGHFWTETNSD
Ga0210133_102498533300025573Natural And Restored WetlandsLRKIKEIKGLRGDVLQYVAQGIPLIDAEMAGKSHLWMKT
Ga0210080_100257613300025969Natural And Restored WetlandsKFKEINKLRGGVLVYAAQAIPPIDAEIAEKGHLWTETT
Ga0209920_100410123300026099SoilLFKVKEIKELRVPSFGREQAIPQIDAEIGEKGHLWMETNYAY
Ga0209951_106700023300026138Pond WaterKEIKGLRGGVLLRYVAQEIPLIDAEIPEKGHLWMETN
Ga0256841_100727223300026534Hydrothermal VentsLRKVKEIKGLRGDVLEYVAQGIPQIDAEIAEKGHLWMETS
Ga0209273_1041607613300027790Marine SedimentRKVKETKGLRGGVLMYAAQEIPLIDAEIPEKGHLWMETK
Ga0209287_1011620823300027792Freshwater SedimentVRSMDAPSQNKELRGDVPRYVAQATPQFDAEIAEKGHLWMETNDE
Ga0209635_1084627023300027888Marine SedimentIFSKIKEIKGLRVPPGGREQGIPQIDAEIAEKGHFWMETR
Ga0209536_10215189213300027917Marine SedimentKVKEIKGLRGGVLKYAAQEILKIDTEIAQKGHLWMETS
Ga0307441_112464713300031276Salt MarshLLKVKEIKELHGGVLLYAAQAIPQIDAEIGQKGHLWM
Ga0307425_120724523300031277Salt MarshIFRKVKKIKGLRGGVPGYLAQAIPQIDAEIAEKGHLWMETSWLS
Ga0307418_108784123300031341Salt MarshKGLRGAVRQYVAQVIPQIDDEIVKNGHLWMETRMKSL
Ga0307418_109786713300031341Salt MarshPARARGTEAPSQIKGLRGGVPGYVAQAIPLIDAEIAEKGHL
Ga0307446_103956413300031354Salt MarshEMRYFFCKIKEIKGLRGDVLWYVAQVIPQIDAETVKNSHLWMETS
Ga0307440_105960213300031367Salt MarshKIKKTKGLRGAVRQYVAQVIPQIDDEIVKNGHLWRETRMKSL
Ga0307423_106502813300031371Salt MarshKEIKELRGGILLYAAQAVPPIDAEIVEKGHLWTETGEDS
Ga0316579_1025807213300031691RhizosphereKEINELRGGILLYTAQAIPPIDTEIAVKGHLWTETS
Ga0316576_1001395023300031727RhizosphereMRCFFKTKKIKGLRGDVREYVAQVIPQGDAEMVKKSRLWMETR
Ga0316576_1098232123300031727RhizosphereMRYFYKIKKIKGFRGDVREYVAQGIPQVDAEIVKKSHLWMETI
Ga0316577_1023783913300031733RhizosphereEIKGLRGGILLYAAQAIPSIDAEIAEKGHLWTETS
Ga0315540_1005371233300032061Salt Marsh SedimentYFFCKIKEIKGLRGDVLWYVAQVIPQIDAETVKNSHLWMETS
Ga0316583_1000196093300032133RhizosphereMRYFYKIKEIKGLRGDVRQYAAQVIPQIDDEMVKNSHLWMETI
Ga0315281_1228092213300032163SedimentLLKVKEIKELRGGVLLYATQAIPQIDAEIGQKGHLWMETI
Ga0316198_10001524113300032251SedimentLFKVKEIKGLRGSDPLYKAQAIPPIDAKIWQKDHLWMETNYNQQVLSIGR
Ga0316196_1023228913300032252SedimentVPGFRKVKKIKGLRGGVLMYAAQEIPLIDAEIPEKGHLWMETN
Ga0316191_1052461813300032258Worm BurrowLFKVKEIKKLRGGVLLYTAQAIPQIDAEIGQKGHL
Ga0316188_1002524833300032276Worm BurrowCKFKEIKELRGGVLLYAAQAIPPIDGEIAEKGHLWMETS
Ga0316596_119092313300033541RhizosphereEIKELRGGILLYAAQAIPPIDAEIAEKGHLWTETS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.