| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300026534 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0046784 | Gp0296307 | Ga0256841 |
| Sample Name | Hydrothermal vent microbial communities from Mid Atlantic Ridge, Atlantic Ocean - 356-308 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 665474504 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1 |
| Not Available | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1 |
| All Organisms → cellular organisms → Bacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine hydrothermal vent biome → marine hydrothermal vent → rock |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Atlantic Ocean: Mid Atlantic Ridge | |||||||
| Coordinates | Lat. (o) | 37.2904 | Long. (o) | -32.2765 | Alt. (m) | N/A | Depth (m) | 1672 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F039145 | Metagenome / Metatranscriptome | 164 | Y |
| F079729 | Metagenome / Metatranscriptome | 115 | Y |
| F099975 | Metagenome / Metatranscriptome | 103 | Y |
| F105196 | Metagenome / Metatranscriptome | 100 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0256841_1000562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 37700 | Open in IMG/M |
| Ga0256841_1004989 | Not Available | 9328 | Open in IMG/M |
| Ga0256841_1007272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 7304 | Open in IMG/M |
| Ga0256841_1211119 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0256841_1000562 | Ga0256841_100056231 | F105196 | MYIIDQCRGPYGALSKSRKMLLEQLLRQPDQCLWERMRGLIIRDIPIVTLEMAVNSVRRNLDAERLPDPFTLYRALRFAVDYATGDTDSARGGICRK |
| Ga0256841_1004989 | Ga0256841_10049899 | F039145 | MKYFLTSLIVSLTLLTGCSQEGMKAPAELSPFIEALKANGVDGTLLVRAPFNEDMEYVAEYTISRYASTRIISVFKFKDSEKAQENLQEALKNDRLSGQTRNGAFVMAVTFYPPDEEAVEKIKALFLAHEFE |
| Ga0256841_1007272 | Ga0256841_10072722 | F099975 | LRKVKEIKGLRGDVLEYVAQGIPQIDAEIAEKGHLWMETS |
| Ga0256841_1211119 | Ga0256841_12111192 | F079729 | LQIIDPYTVRFRFPEPDGGALAKLTIMHMANRQFYHELGWGEKHW |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |