NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F093675

Metagenome / Metatranscriptome Family F093675

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F093675
Family Type Metagenome / Metatranscriptome
Number of Sequences 106
Average Sequence Length 40 residues
Representative Sequence MAPFIAIVLSIGILTLLGIAAGFGIDSRPSYGDDHAR
Number of Associated Samples 95
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 31.82 %
% of genes near scaffold ends (potentially truncated) 14.15 %
% of genes from short scaffolds (< 2000 bps) 16.98 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (79.245 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(21.698 % of family members)
Environment Ontology (ENVO) Unclassified
(28.302 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(37.736 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 41.54%    β-sheet: 0.00%    Coil/Unstructured: 58.46%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF07336ABATE 29.25
PF11706zf-CGNR 16.04
PF13545HTH_Crp_2 0.94
PF08264Anticodon_1 0.94
PF07676PD40 0.94
PF12836HHH_3 0.94
PF03772Competence 0.94
PF00892EamA 0.94

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 106 Family Scaffolds
COG5516Uncharacterized conserved protein containing a Zn-ribbon-like motif, possibly RNA-bindingGeneral function prediction only [R] 29.25
COG0658DNA uptake channel protein ComEC, N-terminal domainIntracellular trafficking, secretion, and vesicular transport [U] 0.94


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A79.25 %
All OrganismsrootAll Organisms20.75 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004114|Ga0062593_102852120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium552Open in IMG/M
3300004153|Ga0063455_100486052All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium763Open in IMG/M
3300005444|Ga0070694_101849880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium515Open in IMG/M
3300005445|Ga0070708_102088313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium524Open in IMG/M
3300005536|Ga0070697_100732523All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi873Open in IMG/M
3300005558|Ga0066698_10360368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1004Open in IMG/M
3300010142|Ga0127483_1215463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium528Open in IMG/M
3300010362|Ga0126377_10031034All Organisms → cellular organisms → Bacteria4515Open in IMG/M
3300010371|Ga0134125_10901937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi971Open in IMG/M
3300010399|Ga0134127_10169090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2005Open in IMG/M
3300012208|Ga0137376_10091451All Organisms → cellular organisms → Bacteria2566Open in IMG/M
3300012212|Ga0150985_110758727All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi895Open in IMG/M
3300012399|Ga0134061_1213996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium546Open in IMG/M
3300012944|Ga0137410_12031704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium511Open in IMG/M
3300018054|Ga0184621_10110554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi978Open in IMG/M
3300018431|Ga0066655_10532620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi782Open in IMG/M
3300020080|Ga0206350_10341369All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi780Open in IMG/M
3300022195|Ga0222625_1723134All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium528Open in IMG/M
3300022195|Ga0222625_1777206All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium557Open in IMG/M
3300022756|Ga0222622_11390304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium517Open in IMG/M
3300025917|Ga0207660_10000002All Organisms → cellular organisms → Bacteria883566Open in IMG/M
3300030829|Ga0308203_1013972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi969Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil21.70%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment5.66%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil5.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.66%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.72%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.77%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.77%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand2.83%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.83%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil2.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.83%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.83%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.83%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.89%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.89%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.89%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.89%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.89%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.89%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.89%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.94%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.94%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.94%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.94%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.94%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.94%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.94%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.94%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.94%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.94%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.94%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001330Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-5cm)- 6 month illuminaEnvironmentalOpen in IMG/M
3300004071Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005830Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBMEnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010142Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011442Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2EnvironmentalOpen in IMG/M
3300012092Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ445A (23.06)EnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012399Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012527Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ83 (22.06)EnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014487Bulk soil microbial communities from Mexico - Magueyal (Ma) metaGEnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300015086Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-5c, rocky medial moraine)EnvironmentalOpen in IMG/M
3300015162Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4c, rock/ice/stream interface)EnvironmentalOpen in IMG/M
3300015192Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2a, rock/snow interface)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015252Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT399_16_10DEnvironmentalOpen in IMG/M
3300017787Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2)EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019269Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300020080Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021151Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_06_16RNAfungal (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021859Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.306 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021951Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022195Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300023058Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m1EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025947Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300027457Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE17-D (SPAdes)EnvironmentalOpen in IMG/M
3300027637Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300030829Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300034652Metatranscriptome of peat soil microbial communities from wetland fen in Alaska, United States - Frozen_pond_02R_16 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10214J12806_1063240623300000891SoilMAPIITIILMIGLMTALGIAAVLWGVDSRPSYGDDHAR*
JGI10216J12902_10003381023300000956SoilMAPIITIVLMVGLLTALGIAAVLWGVDTRPSYGDDHAR*
JGI10216J12902_10656319423300000956SoilMAPMIAMVLSMGIATALGIFAIQFGADSRPTYGDDHAR*
JGI10216J12902_11071353713300000956SoilRRCRMAPFIAIVLSIGILTLLGIAAGFGFDSRPSYGDDHAR*
A305W6_100452553300001330PermafrostMAPFIAIVLSIGIMAAFGIAGAIWGTDSRPSYGDDHAR*
Ga0055486_1008513613300004071Natural And Restored WetlandsRGYGRRCRMAPYIAIVLSIGLLALIGFAAIGWGIDSRPSYSDDHIR*
Ga0062593_10285212023300004114SoilRGYGRDRRCRMAPFIAMLVSIGITTLFGIAALAFGADSRPSYRDDHAR*
Ga0063455_10048605213300004153SoilKGLLRDRRCRMAPFIAMLLSIGITTVFGIAALAFGTDSRPTYLDDHAR*
Ga0062589_10174379923300004156SoilRGYGRERRCRMAPFIAMIMSIGIGTVLGIFALTFGTDSRPTYGDDHAR*
Ga0070683_10010554933300005329Corn RhizosphereMTLEGVTRRRCLMAPFIIMIVLSIGLMALFGIAGGSGIDSRPSYGDDHAR*
Ga0070691_1012557613300005341Corn, Switchgrass And Miscanthus RhizosphereRKKTQKGLRERKRRCLMAPLIAMIASIGIASVFGMIAFTFGSDSRPTYGDDHAR*
Ga0070694_10184988013300005444Corn, Switchgrass And Miscanthus RhizosphereEQPRRGYGTDRRRRMAPFIVMIVSIGITTVFGIAALAFGVDSRPTYGDDHAR*
Ga0070708_10208831313300005445Corn, Switchgrass And Miscanthus RhizosphereRRCRMAPFIAIILSIGIATLIGIAAAGFGADTRPTYRDDHAR*
Ga0070697_10073252333300005536Corn, Switchgrass And Miscanthus RhizosphereRRCRMAPLIAIILTIGLLIVLGIAAQDWGTDSRPSYGDDHAR*
Ga0066695_1010100333300005553SoilMAPLIAIILTIGILILLGIAAQDWGADSRPTYGDDHAR*
Ga0066698_1036036823300005558SoilMAPFIGIILWIGITIVLGIAAVTFGTDSTPTYGDDHAR*
Ga0068866_1092554213300005718Miscanthus RhizosphereMAPFIAIILSIGIATLIGIAAAGFGADTRPTYRDDHAR*
Ga0068861_10051055933300005719Switchgrass RhizosphereMAPFIAIVLSIGILTLLGIAAGFGIDSRPSYGDDHAR*
Ga0074473_1101360023300005830Sediment (Intertidal)MAPFIAIILTIGLMTLLGVAASVGADSRPSYGDDHTR*
Ga0068858_10220311423300005842Switchgrass RhizosphereMAPFIMIVLSIGLLALFGLAAGTGIDSRPSYGDDHAR*
Ga0068860_10136910413300005843Switchgrass RhizosphereMAPFIMIVLSIGLLALFGLAAGSGIDSRPSYGDDHAR*
Ga0079222_1095081713300006755Agricultural SoilMAPFIMIVLSIGLMGLLGIASVGWGIDSRPSYGDDHAR*
Ga0075428_10089544813300006844Populus RhizosphereMAPIITIVLMVGLLTALGIAAVLWGVDSRPSYGDDHAR*
Ga0079217_1044229523300006876Agricultural SoilMVPFIAIVLSIGILTALGIAAVLWGADSRPTYGDDHAR*
Ga0075426_1068373133300006903Populus RhizospherePFIAIVLSIGIMTAFGIAAAIWGTDSRPTYRDDHAR*
Ga0079219_1171885723300006954Agricultural SoilMAPFIMIVLSIGLMALLGFASAGWGTDSRPSYGDDHAR*
Ga0111538_1092880633300009156Populus RhizosphereREEPKRGYSRDRRCRMAPFIALLLSIGITTVIGMAALTFGADSRPSYSDDHAR*
Ga0126313_1175805923300009840Serpentine SoilMAPFIIMIVLSVGLMALLGIAGGVGIDSRPSYGDDHAR*
Ga0126312_1132981713300010041Serpentine SoilMVAIVSIVLMVGIMSALGIAAGLWGVDSRPSYGDDHAR*
Ga0126311_1098392323300010045Serpentine SoilMIAMILSIGLTTILGFAALTWGVDSRPSIGDDHAR*
Ga0127483_121546313300010142Grasslands SoilRERRCRMAPLIAIILTIGILILLGIAAQDWGADSRPTYGDDHAR*
Ga0126377_1003103433300010362Tropical Forest SoilMAPYIAILMSIGITTLIGIAALAFGTDSRPTYGDDHAR*
Ga0134125_1090193713300010371Terrestrial SoilMAPFIAIILSIGLTTLIGIAAAGFGADTRPTYRDDHAR*
Ga0134124_1014880543300010397Terrestrial SoilMAPFIAIVLLIGIMSALGIAAAMWGTDSRPTYVDDHAR*
Ga0134127_1016650943300010399Terrestrial SoilMAPFIAIILSIGFATLIGIAAAGFGADTRPTYRDDHAR*
Ga0134127_1016909043300010399Terrestrial SoilTKKRLREKERRCRMASLIFIALMIGIMTSLGIAAVLYGNDSRPSYGDDHAR*
Ga0134127_1253946323300010399Terrestrial SoilMAPIITIVLMVGIMTALGVAATYWGVDSRPSYRDDHAR*
Ga0134122_1247406313300010400Terrestrial SoilMAPFIAIVLSIGILTLLGMLAGFGTDSRPSYGDDHAR*
Ga0137437_121409323300011442SoilMALFIAIVLLIGIMAAFGIAAAVWGTDSRPSYGDDHAR*
Ga0136621_123521023300012092Polar Desert SandMAPFIAIILSMGIMTALGIAAALWGTASRPSYGDDHAR*
Ga0137376_1009145143300012208Vadose Zone SoilMAPLIAIILTIGILILLGIAAQDWGADSRPTYRDDHAR*
Ga0150985_11075872713300012212Avena Fatua RhizosphereTQKGLLRDRRCRMAPFIAMLLSIGITTVFGIAALAFGTDSRPTYLDDHAR*
Ga0134061_121399613300012399Grasslands SoilPRRGYGKERRCRMAPLIAIIFTIGILILLGIAAQDWGADSRPTYGDDHAR*
Ga0136633_129585713300012527Polar Desert SandMAPFIAIVLSIGIMTALGIAAFLWGFDSRPTYGDDHTR*
Ga0137396_1125775413300012918Vadose Zone SoilMAPLIAIIMTIGILVLLGIAAQNWGEDSRPTYGDDHAR*
Ga0137410_1203170413300012944Vadose Zone SoilERRCRMAPLIAIIMTIGILILLGIAAQDWGEDSRPTYGDDHAR*
Ga0164304_1132368923300012986SoilMAPFIAIVLSIGIMTAFGIAAAIWGTDSRPTYGDDHAR*
Ga0163163_1289176123300014325Switchgrass RhizosphereMAPFMMIVLSIGLLALFGLAAGSGIDSRPSYGDDHAR*
Ga0182000_1056294913300014487SoilMAPIITIVLMVGIMTALGVAAALWGVDSRPSYGDDHAR*
Ga0182008_1023669823300014497RhizosphereMAPFIIMIVLSIGLMALFGIAGGSGIDSRPSYGDDHAR*
Ga0182008_1073413513300014497RhizosphereMAPFIAIVLSIGIMSAVGIAAALWGTDSRPSYGDDHAR*
Ga0167655_100643963300015086Glacier Forefield SoilMAPFIAIVLSIGIMTLLGIAAGIGVDSRPSYGDDHAR*
Ga0167653_103743923300015162Glacier Forefield SoilMAPFIAIVLLIGIMCALGIAAAMWGTDSRPTYADDHAR*
Ga0167646_101736633300015192Glacier Forefield SoilMAPFIAIVLSIGILSLLGIFAGFGIDSRPSYGDDHAR*
Ga0137418_1071672523300015241Vadose Zone SoilMAPLIAIIMTIGILILLGIAAQDWGEDSRPTYGDDHAR*
Ga0180075_110425613300015252SoilMAPFIAIVLLIGIMAAFGIAAAVWGTDSRPSYGDDHAR*
Ga0183260_1011979623300017787Polar Desert SandMAPFIAIFLSMGIMTALGIAAALWGTDSRPSYGDDHAR
Ga0184621_1011055413300018054Groundwater SedimentMAPFIAVILTIGLLIVLGIAAQDWGTDSRPTYGDDHAR
Ga0184632_1010123323300018075Groundwater SedimentMAPLIAIVLTIGIMTAIGIAALTWGVDTTPSYGDDHAR
Ga0190265_1126400923300018422SoilMAPFIAIVLSMGILTALGIAAVLWGADSRPTYRDDHAR
Ga0190272_1041558123300018429SoilMAPFIAIVLSMGILTALGIAAVLWGADSRPTYGDDHAR
Ga0190272_1324681423300018429SoilMAPFIAIILSMGILTALGIAAVLWGADSRPTYGDDHAR
Ga0066655_1053262013300018431Grasslands SoilLIAIILTIGILILLGIAAQDWGADSRPTYGDDHAR
Ga0190275_1021573343300018432SoilMAPMITIVLMVGLLTALGIAAVLWGVDTRPSYGDDHAR
Ga0066667_1095734423300018433Grasslands SoilMAPLIAIILTIGILILLGIAAQDWGADSRPTYGDDHAR
Ga0190268_1100303813300018466SoilMAPIITIVLIVGLMTALGIAAVLWGVDSRPSYGDDHAR
Ga0190268_1166055013300018466SoilMAPIITIVLMVGLLTALGIAAVLWGVDTRPSYGDDHAR
Ga0190270_1114935323300018469SoilMAPIITIFLIVGLMTALGIAAVLWGVDTRPSYGDDHAR
Ga0190274_1277243513300018476SoilMAPIITIVLMVGLMTALGIAAVLWGVDSRPSYGDDHAR
Ga0184644_153869513300019269Groundwater SedimentMAPFIAIVLSIGILTLLGMAAGFGIDSRPSYGDDHAR
Ga0190264_1092498033300019377SoilMAPIITIFLIVGLMAALGIAAVLWGVDTRPSYGDDHAR
Ga0190264_1208799023300019377SoilMAPIITIGLILGLMTALGIAAVLWGVDSRPSYGDDHAR
Ga0190267_1002133633300019767SoilMAPIITIVLMVGLMTALGIAAVLWGVDTRPSYGDDHAR
Ga0206350_1034136913300020080Corn, Switchgrass And Miscanthus RhizosphereEPKRGYSRDRRCRMAPFIALLLSIGITTVIGMAALTFGADSRPSYSDDHAR
Ga0179584_146436533300021151Vadose Zone SoilPRHGLRSEKRRCRMAPFIAFVLSIGILTAFGIAAAIWGTDSRSTYRDDHAR
Ga0193699_1049481013300021363SoilMAPFIAIVLSIGLLTLLGMLAGFGIDSRPSYGDDHAR
Ga0210334_1015159333300021859EstuarineMAPFIAIILTIGLMTLLGVAASVGADSRPSYGDDHTR
Ga0222624_155557113300021951Groundwater SedimentMAPFIAIVLSIGILTLLGMLAGFGTDSRPSYGDDHAR
Ga0222625_124200433300022195Groundwater SedimentMAPIITIVLTIGIMTALGTIAALWGVDSRPSYGDDHAR
Ga0222625_148395523300022195Groundwater SedimentMAPIITIFLIVGLMTALGIAAVLWGVDSRPSYGDDHAR
Ga0222625_172313413300022195Groundwater SedimentMAPFIAIILTLGILIVLGIAAQDWGADSRPTYGDDHARSSETTST
Ga0222625_177720613300022195Groundwater SedimentSPRRGYGRERRCRMAPFILMIVPIGILVILGIAALTFGTDSRPTIGDDHAR
Ga0222622_1139030423300022756Groundwater SedimentRRCRMAPFIAVILTIGLLIVLGIAAQDWGTDSRPTYGDDHAR
Ga0193714_102853623300023058SoilMAPFIAIVLSIGILTAFGIVAAIWGTDSRPTYRDDHAR
Ga0209640_1121879713300025324SoilMAPLITIVLSIGILALFGFAALRWGVDSRPTYRDDHAR
Ga0207660_100000027903300025917Corn RhizosphereMAPFIAIILSIGFATLIGIAAAGFGADTRPTYRDDHAR
Ga0207662_1122652213300025918Switchgrass RhizosphereGGYARRCRMAPFIMIVLSIGLLALFGLAAGSGIDSRPSYGDDHAR
Ga0210067_101426723300025947Natural And Restored WetlandsMAPYIAIVLSIGLLALIGFAAIGWGIDSRPSYSDDHIR
Ga0207625_10107433300027457SoilMAPFIAIVLSIGIMIAFGIAAAIWGSDSRPTYGDDHAR
Ga0209818_119638923300027637Agricultural SoilMVPFIAIVLSIGILTALGIAAVLWGADSRPTYGDDHAR
Ga0268264_1210472613300028381Switchgrass RhizosphereGLRERKRRCRMAPLIAMIASIGIASVFGMIAYTFGTDSRPTYGDDHAR
Ga0247818_1067119623300028589SoilMAPIITIILMIGLMTALGIAAVLWGVDSRPSYGDDHAR
Ga0307322_1016591623300028710SoilMAPFIAIVLSIGILTLFGIAAGFGIDSRPSYGDDHAR
Ga0307280_1009710723300028768SoilMAPFIAIVLSIGIMVAFGIAGAIWGTDSRPSYGDDHAR
Ga0307282_1017987023300028784SoilMAPFIAIILTIGVLIVLGIAAQDWGADSRPSYGDDHTR
Ga0307296_1003184043300028819SoilMAPFIAVILTIGLLIVLGIVAQDWGTDSRPTYGDDHAR
Ga0307277_1007465313300028881SoilMAPFIAIILTIGILIVLGIAAQDWGTDSRPSYGDD
Ga0307308_1024963033300028884SoilRRGYGRDRRCRMAPFIAIILTIGILIVLGIAAQDWGADSRPTYGDDHARSSETTST
Ga0308203_101397213300030829SoilRGYGKDRRCRMAPFIAMIASIGIGTVFGILAFTFGTDSRPTYGDDHAR
Ga0307408_10085221723300031548RhizosphereMAPFIMIVLSIGLLALIGTAGLGWGSDSRPSYGDDHAR
Ga0310813_1232630813300031716SoilMTLKGVTQRRCRMAPFIIMIVLSIGLMALLGIAGGMGIDSRPSYGDDHAR
Ga0307468_10206809923300031740Hardwood Forest SoilMAPFIAIVLSIGILTLLGIAAGIGIDSRPSYGDDHAR
Ga0326597_1166129823300031965SoilMAPIIAIVLSIGILTAFGIAAVLWGVDSRPTIGDDHARWAGPSPR
Ga0307416_10122745313300032002RhizosphereMAPIITIVLMVGLLTALGMAALLWGVDTRPSYGDDHAR
Ga0307411_1053486323300032005RhizosphereMAPMIAMVLSMGIATALGIFAIQFGVDSRPTYGDDHTR
Ga0316598_204772_402_5153300034652Untreated Peat SoilMAPFIAIVLSIGILTLLGIAAGIGFDSRPTYVDDHAR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.