Basic Information | |
---|---|
Family ID | F093675 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 106 |
Average Sequence Length | 40 residues |
Representative Sequence | MAPFIAIVLSIGILTLLGIAAGFGIDSRPSYGDDHAR |
Number of Associated Samples | 95 |
Number of Associated Scaffolds | 106 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 31.82 % |
% of genes near scaffold ends (potentially truncated) | 14.15 % |
% of genes from short scaffolds (< 2000 bps) | 16.98 % |
Associated GOLD sequencing projects | 92 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (79.245 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (21.698 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.302 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.736 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 41.54% β-sheet: 0.00% Coil/Unstructured: 58.46% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 106 Family Scaffolds |
---|---|---|
PF07336 | ABATE | 29.25 |
PF11706 | zf-CGNR | 16.04 |
PF13545 | HTH_Crp_2 | 0.94 |
PF08264 | Anticodon_1 | 0.94 |
PF07676 | PD40 | 0.94 |
PF12836 | HHH_3 | 0.94 |
PF03772 | Competence | 0.94 |
PF00892 | EamA | 0.94 |
COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
---|---|---|---|
COG5516 | Uncharacterized conserved protein containing a Zn-ribbon-like motif, possibly RNA-binding | General function prediction only [R] | 29.25 |
COG0658 | DNA uptake channel protein ComEC, N-terminal domain | Intracellular trafficking, secretion, and vesicular transport [U] | 0.94 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 79.25 % |
All Organisms | root | All Organisms | 20.75 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004114|Ga0062593_102852120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 552 | Open in IMG/M |
3300004153|Ga0063455_100486052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 763 | Open in IMG/M |
3300005444|Ga0070694_101849880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 515 | Open in IMG/M |
3300005445|Ga0070708_102088313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 524 | Open in IMG/M |
3300005536|Ga0070697_100732523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 873 | Open in IMG/M |
3300005558|Ga0066698_10360368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1004 | Open in IMG/M |
3300010142|Ga0127483_1215463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 528 | Open in IMG/M |
3300010362|Ga0126377_10031034 | All Organisms → cellular organisms → Bacteria | 4515 | Open in IMG/M |
3300010371|Ga0134125_10901937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 971 | Open in IMG/M |
3300010399|Ga0134127_10169090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2005 | Open in IMG/M |
3300012208|Ga0137376_10091451 | All Organisms → cellular organisms → Bacteria | 2566 | Open in IMG/M |
3300012212|Ga0150985_110758727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 895 | Open in IMG/M |
3300012399|Ga0134061_1213996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 546 | Open in IMG/M |
3300012944|Ga0137410_12031704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 511 | Open in IMG/M |
3300018054|Ga0184621_10110554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 978 | Open in IMG/M |
3300018431|Ga0066655_10532620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 782 | Open in IMG/M |
3300020080|Ga0206350_10341369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 780 | Open in IMG/M |
3300022195|Ga0222625_1723134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 528 | Open in IMG/M |
3300022195|Ga0222625_1777206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 557 | Open in IMG/M |
3300022756|Ga0222622_11390304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 517 | Open in IMG/M |
3300025917|Ga0207660_10000002 | All Organisms → cellular organisms → Bacteria | 883566 | Open in IMG/M |
3300030829|Ga0308203_1013972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 969 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 21.70% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 5.66% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.66% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.66% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.72% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.77% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.77% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.77% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 2.83% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.83% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 2.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.83% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.83% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.83% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.89% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.89% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.89% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.89% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.89% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.89% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.89% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.94% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.94% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.94% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.94% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.94% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.94% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.94% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.94% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.94% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.94% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.94% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.94% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.94% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.94% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001330 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-5cm)- 6 month illumina | Environmental | Open in IMG/M |
3300004071 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005830 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010142 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
3300012092 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ445A (23.06) | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012399 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012527 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ83 (22.06) | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300015086 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-5c, rocky medial moraine) | Environmental | Open in IMG/M |
3300015162 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4c, rock/ice/stream interface) | Environmental | Open in IMG/M |
3300015192 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2a, rock/snow interface) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015252 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT399_16_10D | Environmental | Open in IMG/M |
3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021151 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
3300021859 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.306 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021951 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300023058 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m1 | Environmental | Open in IMG/M |
3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025947 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300027457 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE17-D (SPAdes) | Environmental | Open in IMG/M |
3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300030829 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
3300034652 | Metatranscriptome of peat soil microbial communities from wetland fen in Alaska, United States - Frozen_pond_02R_16 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10214J12806_106324062 | 3300000891 | Soil | MAPIITIILMIGLMTALGIAAVLWGVDSRPSYGDDHAR* |
JGI10216J12902_1000338102 | 3300000956 | Soil | MAPIITIVLMVGLLTALGIAAVLWGVDTRPSYGDDHAR* |
JGI10216J12902_1065631942 | 3300000956 | Soil | MAPMIAMVLSMGIATALGIFAIQFGADSRPTYGDDHAR* |
JGI10216J12902_1107135371 | 3300000956 | Soil | RRCRMAPFIAIVLSIGILTLLGIAAGFGFDSRPSYGDDHAR* |
A305W6_10045255 | 3300001330 | Permafrost | MAPFIAIVLSIGIMAAFGIAGAIWGTDSRPSYGDDHAR* |
Ga0055486_100851361 | 3300004071 | Natural And Restored Wetlands | RGYGRRCRMAPYIAIVLSIGLLALIGFAAIGWGIDSRPSYSDDHIR* |
Ga0062593_1028521202 | 3300004114 | Soil | RGYGRDRRCRMAPFIAMLVSIGITTLFGIAALAFGADSRPSYRDDHAR* |
Ga0063455_1004860521 | 3300004153 | Soil | KGLLRDRRCRMAPFIAMLLSIGITTVFGIAALAFGTDSRPTYLDDHAR* |
Ga0062589_1017437992 | 3300004156 | Soil | RGYGRERRCRMAPFIAMIMSIGIGTVLGIFALTFGTDSRPTYGDDHAR* |
Ga0070683_1001055493 | 3300005329 | Corn Rhizosphere | MTLEGVTRRRCLMAPFIIMIVLSIGLMALFGIAGGSGIDSRPSYGDDHAR* |
Ga0070691_101255761 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | RKKTQKGLRERKRRCLMAPLIAMIASIGIASVFGMIAFTFGSDSRPTYGDDHAR* |
Ga0070694_1018498801 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | EQPRRGYGTDRRRRMAPFIVMIVSIGITTVFGIAALAFGVDSRPTYGDDHAR* |
Ga0070708_1020883131 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | RRCRMAPFIAIILSIGIATLIGIAAAGFGADTRPTYRDDHAR* |
Ga0070697_1007325233 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | RRCRMAPLIAIILTIGLLIVLGIAAQDWGTDSRPSYGDDHAR* |
Ga0066695_101010033 | 3300005553 | Soil | MAPLIAIILTIGILILLGIAAQDWGADSRPTYGDDHAR* |
Ga0066698_103603682 | 3300005558 | Soil | MAPFIGIILWIGITIVLGIAAVTFGTDSTPTYGDDHAR* |
Ga0068866_109255421 | 3300005718 | Miscanthus Rhizosphere | MAPFIAIILSIGIATLIGIAAAGFGADTRPTYRDDHAR* |
Ga0068861_1005105593 | 3300005719 | Switchgrass Rhizosphere | MAPFIAIVLSIGILTLLGIAAGFGIDSRPSYGDDHAR* |
Ga0074473_110136002 | 3300005830 | Sediment (Intertidal) | MAPFIAIILTIGLMTLLGVAASVGADSRPSYGDDHTR* |
Ga0068858_1022031142 | 3300005842 | Switchgrass Rhizosphere | MAPFIMIVLSIGLLALFGLAAGTGIDSRPSYGDDHAR* |
Ga0068860_1013691041 | 3300005843 | Switchgrass Rhizosphere | MAPFIMIVLSIGLLALFGLAAGSGIDSRPSYGDDHAR* |
Ga0079222_109508171 | 3300006755 | Agricultural Soil | MAPFIMIVLSIGLMGLLGIASVGWGIDSRPSYGDDHAR* |
Ga0075428_1008954481 | 3300006844 | Populus Rhizosphere | MAPIITIVLMVGLLTALGIAAVLWGVDSRPSYGDDHAR* |
Ga0079217_104422952 | 3300006876 | Agricultural Soil | MVPFIAIVLSIGILTALGIAAVLWGADSRPTYGDDHAR* |
Ga0075426_106837313 | 3300006903 | Populus Rhizosphere | PFIAIVLSIGIMTAFGIAAAIWGTDSRPTYRDDHAR* |
Ga0079219_117188572 | 3300006954 | Agricultural Soil | MAPFIMIVLSIGLMALLGFASAGWGTDSRPSYGDDHAR* |
Ga0111538_109288063 | 3300009156 | Populus Rhizosphere | REEPKRGYSRDRRCRMAPFIALLLSIGITTVIGMAALTFGADSRPSYSDDHAR* |
Ga0126313_117580592 | 3300009840 | Serpentine Soil | MAPFIIMIVLSVGLMALLGIAGGVGIDSRPSYGDDHAR* |
Ga0126312_113298171 | 3300010041 | Serpentine Soil | MVAIVSIVLMVGIMSALGIAAGLWGVDSRPSYGDDHAR* |
Ga0126311_109839232 | 3300010045 | Serpentine Soil | MIAMILSIGLTTILGFAALTWGVDSRPSIGDDHAR* |
Ga0127483_12154631 | 3300010142 | Grasslands Soil | RERRCRMAPLIAIILTIGILILLGIAAQDWGADSRPTYGDDHAR* |
Ga0126377_100310343 | 3300010362 | Tropical Forest Soil | MAPYIAILMSIGITTLIGIAALAFGTDSRPTYGDDHAR* |
Ga0134125_109019371 | 3300010371 | Terrestrial Soil | MAPFIAIILSIGLTTLIGIAAAGFGADTRPTYRDDHAR* |
Ga0134124_101488054 | 3300010397 | Terrestrial Soil | MAPFIAIVLLIGIMSALGIAAAMWGTDSRPTYVDDHAR* |
Ga0134127_101665094 | 3300010399 | Terrestrial Soil | MAPFIAIILSIGFATLIGIAAAGFGADTRPTYRDDHAR* |
Ga0134127_101690904 | 3300010399 | Terrestrial Soil | TKKRLREKERRCRMASLIFIALMIGIMTSLGIAAVLYGNDSRPSYGDDHAR* |
Ga0134127_125394632 | 3300010399 | Terrestrial Soil | MAPIITIVLMVGIMTALGVAATYWGVDSRPSYRDDHAR* |
Ga0134122_124740631 | 3300010400 | Terrestrial Soil | MAPFIAIVLSIGILTLLGMLAGFGTDSRPSYGDDHAR* |
Ga0137437_12140932 | 3300011442 | Soil | MALFIAIVLLIGIMAAFGIAAAVWGTDSRPSYGDDHAR* |
Ga0136621_12352102 | 3300012092 | Polar Desert Sand | MAPFIAIILSMGIMTALGIAAALWGTASRPSYGDDHAR* |
Ga0137376_100914514 | 3300012208 | Vadose Zone Soil | MAPLIAIILTIGILILLGIAAQDWGADSRPTYRDDHAR* |
Ga0150985_1107587271 | 3300012212 | Avena Fatua Rhizosphere | TQKGLLRDRRCRMAPFIAMLLSIGITTVFGIAALAFGTDSRPTYLDDHAR* |
Ga0134061_12139961 | 3300012399 | Grasslands Soil | PRRGYGKERRCRMAPLIAIIFTIGILILLGIAAQDWGADSRPTYGDDHAR* |
Ga0136633_12958571 | 3300012527 | Polar Desert Sand | MAPFIAIVLSIGIMTALGIAAFLWGFDSRPTYGDDHTR* |
Ga0137396_112577541 | 3300012918 | Vadose Zone Soil | MAPLIAIIMTIGILVLLGIAAQNWGEDSRPTYGDDHAR* |
Ga0137410_120317041 | 3300012944 | Vadose Zone Soil | ERRCRMAPLIAIIMTIGILILLGIAAQDWGEDSRPTYGDDHAR* |
Ga0164304_113236892 | 3300012986 | Soil | MAPFIAIVLSIGIMTAFGIAAAIWGTDSRPTYGDDHAR* |
Ga0163163_128917612 | 3300014325 | Switchgrass Rhizosphere | MAPFMMIVLSIGLLALFGLAAGSGIDSRPSYGDDHAR* |
Ga0182000_105629491 | 3300014487 | Soil | MAPIITIVLMVGIMTALGVAAALWGVDSRPSYGDDHAR* |
Ga0182008_102366982 | 3300014497 | Rhizosphere | MAPFIIMIVLSIGLMALFGIAGGSGIDSRPSYGDDHAR* |
Ga0182008_107341351 | 3300014497 | Rhizosphere | MAPFIAIVLSIGIMSAVGIAAALWGTDSRPSYGDDHAR* |
Ga0167655_10064396 | 3300015086 | Glacier Forefield Soil | MAPFIAIVLSIGIMTLLGIAAGIGVDSRPSYGDDHAR* |
Ga0167653_10374392 | 3300015162 | Glacier Forefield Soil | MAPFIAIVLLIGIMCALGIAAAMWGTDSRPTYADDHAR* |
Ga0167646_10173663 | 3300015192 | Glacier Forefield Soil | MAPFIAIVLSIGILSLLGIFAGFGIDSRPSYGDDHAR* |
Ga0137418_107167252 | 3300015241 | Vadose Zone Soil | MAPLIAIIMTIGILILLGIAAQDWGEDSRPTYGDDHAR* |
Ga0180075_11042561 | 3300015252 | Soil | MAPFIAIVLLIGIMAAFGIAAAVWGTDSRPSYGDDHAR* |
Ga0183260_101197962 | 3300017787 | Polar Desert Sand | MAPFIAIFLSMGIMTALGIAAALWGTDSRPSYGDDHAR |
Ga0184621_101105541 | 3300018054 | Groundwater Sediment | MAPFIAVILTIGLLIVLGIAAQDWGTDSRPTYGDDHAR |
Ga0184632_101012332 | 3300018075 | Groundwater Sediment | MAPLIAIVLTIGIMTAIGIAALTWGVDTTPSYGDDHAR |
Ga0190265_112640092 | 3300018422 | Soil | MAPFIAIVLSMGILTALGIAAVLWGADSRPTYRDDHAR |
Ga0190272_104155812 | 3300018429 | Soil | MAPFIAIVLSMGILTALGIAAVLWGADSRPTYGDDHAR |
Ga0190272_132468142 | 3300018429 | Soil | MAPFIAIILSMGILTALGIAAVLWGADSRPTYGDDHAR |
Ga0066655_105326201 | 3300018431 | Grasslands Soil | LIAIILTIGILILLGIAAQDWGADSRPTYGDDHAR |
Ga0190275_102157334 | 3300018432 | Soil | MAPMITIVLMVGLLTALGIAAVLWGVDTRPSYGDDHAR |
Ga0066667_109573442 | 3300018433 | Grasslands Soil | MAPLIAIILTIGILILLGIAAQDWGADSRPTYGDDHAR |
Ga0190268_110030381 | 3300018466 | Soil | MAPIITIVLIVGLMTALGIAAVLWGVDSRPSYGDDHAR |
Ga0190268_116605501 | 3300018466 | Soil | MAPIITIVLMVGLLTALGIAAVLWGVDTRPSYGDDHAR |
Ga0190270_111493532 | 3300018469 | Soil | MAPIITIFLIVGLMTALGIAAVLWGVDTRPSYGDDHAR |
Ga0190274_127724351 | 3300018476 | Soil | MAPIITIVLMVGLMTALGIAAVLWGVDSRPSYGDDHAR |
Ga0184644_15386951 | 3300019269 | Groundwater Sediment | MAPFIAIVLSIGILTLLGMAAGFGIDSRPSYGDDHAR |
Ga0190264_109249803 | 3300019377 | Soil | MAPIITIFLIVGLMAALGIAAVLWGVDTRPSYGDDHAR |
Ga0190264_120879902 | 3300019377 | Soil | MAPIITIGLILGLMTALGIAAVLWGVDSRPSYGDDHAR |
Ga0190267_100213363 | 3300019767 | Soil | MAPIITIVLMVGLMTALGIAAVLWGVDTRPSYGDDHAR |
Ga0206350_103413691 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | EPKRGYSRDRRCRMAPFIALLLSIGITTVIGMAALTFGADSRPSYSDDHAR |
Ga0179584_14643653 | 3300021151 | Vadose Zone Soil | PRHGLRSEKRRCRMAPFIAFVLSIGILTAFGIAAAIWGTDSRSTYRDDHAR |
Ga0193699_104948101 | 3300021363 | Soil | MAPFIAIVLSIGLLTLLGMLAGFGIDSRPSYGDDHAR |
Ga0210334_101515933 | 3300021859 | Estuarine | MAPFIAIILTIGLMTLLGVAASVGADSRPSYGDDHTR |
Ga0222624_15555711 | 3300021951 | Groundwater Sediment | MAPFIAIVLSIGILTLLGMLAGFGTDSRPSYGDDHAR |
Ga0222625_12420043 | 3300022195 | Groundwater Sediment | MAPIITIVLTIGIMTALGTIAALWGVDSRPSYGDDHAR |
Ga0222625_14839552 | 3300022195 | Groundwater Sediment | MAPIITIFLIVGLMTALGIAAVLWGVDSRPSYGDDHAR |
Ga0222625_17231341 | 3300022195 | Groundwater Sediment | MAPFIAIILTLGILIVLGIAAQDWGADSRPTYGDDHARSSETTST |
Ga0222625_17772061 | 3300022195 | Groundwater Sediment | SPRRGYGRERRCRMAPFILMIVPIGILVILGIAALTFGTDSRPTIGDDHAR |
Ga0222622_113903042 | 3300022756 | Groundwater Sediment | RRCRMAPFIAVILTIGLLIVLGIAAQDWGTDSRPTYGDDHAR |
Ga0193714_10285362 | 3300023058 | Soil | MAPFIAIVLSIGILTAFGIVAAIWGTDSRPTYRDDHAR |
Ga0209640_112187971 | 3300025324 | Soil | MAPLITIVLSIGILALFGFAALRWGVDSRPTYRDDHAR |
Ga0207660_10000002790 | 3300025917 | Corn Rhizosphere | MAPFIAIILSIGFATLIGIAAAGFGADTRPTYRDDHAR |
Ga0207662_112265221 | 3300025918 | Switchgrass Rhizosphere | GGYARRCRMAPFIMIVLSIGLLALFGLAAGSGIDSRPSYGDDHAR |
Ga0210067_10142672 | 3300025947 | Natural And Restored Wetlands | MAPYIAIVLSIGLLALIGFAAIGWGIDSRPSYSDDHIR |
Ga0207625_1010743 | 3300027457 | Soil | MAPFIAIVLSIGIMIAFGIAAAIWGSDSRPTYGDDHAR |
Ga0209818_11963892 | 3300027637 | Agricultural Soil | MVPFIAIVLSIGILTALGIAAVLWGADSRPTYGDDHAR |
Ga0268264_121047261 | 3300028381 | Switchgrass Rhizosphere | GLRERKRRCRMAPLIAMIASIGIASVFGMIAYTFGTDSRPTYGDDHAR |
Ga0247818_106711962 | 3300028589 | Soil | MAPIITIILMIGLMTALGIAAVLWGVDSRPSYGDDHAR |
Ga0307322_101659162 | 3300028710 | Soil | MAPFIAIVLSIGILTLFGIAAGFGIDSRPSYGDDHAR |
Ga0307280_100971072 | 3300028768 | Soil | MAPFIAIVLSIGIMVAFGIAGAIWGTDSRPSYGDDHAR |
Ga0307282_101798702 | 3300028784 | Soil | MAPFIAIILTIGVLIVLGIAAQDWGADSRPSYGDDHTR |
Ga0307296_100318404 | 3300028819 | Soil | MAPFIAVILTIGLLIVLGIVAQDWGTDSRPTYGDDHAR |
Ga0307277_100746531 | 3300028881 | Soil | MAPFIAIILTIGILIVLGIAAQDWGTDSRPSYGDD |
Ga0307308_102496303 | 3300028884 | Soil | RRGYGRDRRCRMAPFIAIILTIGILIVLGIAAQDWGADSRPTYGDDHARSSETTST |
Ga0308203_10139721 | 3300030829 | Soil | RGYGKDRRCRMAPFIAMIASIGIGTVFGILAFTFGTDSRPTYGDDHAR |
Ga0307408_1008522172 | 3300031548 | Rhizosphere | MAPFIMIVLSIGLLALIGTAGLGWGSDSRPSYGDDHAR |
Ga0310813_123263081 | 3300031716 | Soil | MTLKGVTQRRCRMAPFIIMIVLSIGLMALLGIAGGMGIDSRPSYGDDHAR |
Ga0307468_1020680992 | 3300031740 | Hardwood Forest Soil | MAPFIAIVLSIGILTLLGIAAGIGIDSRPSYGDDHAR |
Ga0326597_116612982 | 3300031965 | Soil | MAPIIAIVLSIGILTAFGIAAVLWGVDSRPTIGDDHARWAGPSPR |
Ga0307416_1012274531 | 3300032002 | Rhizosphere | MAPIITIVLMVGLLTALGMAALLWGVDTRPSYGDDHAR |
Ga0307411_105348632 | 3300032005 | Rhizosphere | MAPMIAMVLSMGIATALGIFAIQFGVDSRPTYGDDHTR |
Ga0316598_204772_402_515 | 3300034652 | Untreated Peat Soil | MAPFIAIVLSIGILTLLGIAAGIGFDSRPTYVDDHAR |
⦗Top⦘ |