NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F084728

Metagenome / Metatranscriptome Family F084728

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F084728
Family Type Metagenome / Metatranscriptome
Number of Sequences 112
Average Sequence Length 75 residues
Representative Sequence VRNNYASFSEIKTKTITVQASNNRGDSKKAKLFITLKRSPEFFENMKKFNEIREENEKKASTLAEERKTTQ
Number of Associated Samples 98
Number of Associated Scaffolds 112

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 9.82 %
% of genes near scaffold ends (potentially truncated) 46.43 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (98.214 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(34.821 % of family members)
Environment Ontology (ENVO) Unclassified
(58.036 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(70.536 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 29.29%    β-sheet: 21.21%    Coil/Unstructured: 49.49%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 112 Family Scaffolds
PF01918Alba 13.39

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 112 Family Scaffolds
COG1581DNA/RNA-binding protein AlbA/Ssh10bTranscription [K] 13.39

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.21 %
UnclassifiedrootN/A1.79 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002835|B570J40625_100368961All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta1412Open in IMG/M
3300004463|Ga0063356_105758584All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea531Open in IMG/M
3300005662|Ga0078894_11570486All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea544Open in IMG/M
3300006164|Ga0075441_10070404All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1363Open in IMG/M
3300006384|Ga0075516_1221948All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea645Open in IMG/M
3300006396|Ga0075493_1523887All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea799Open in IMG/M
3300006402|Ga0075511_1414097All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea556Open in IMG/M
3300006917|Ga0075472_10588142All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea557Open in IMG/M
3300007593|Ga0102918_1063836All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1070Open in IMG/M
3300007649|Ga0102912_1038629All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1391Open in IMG/M
3300008508|Ga0110932_1163658All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea670Open in IMG/M
3300008835|Ga0103883_1017971All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea750Open in IMG/M
3300008835|Ga0103883_1026373All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea679Open in IMG/M
3300008835|Ga0103883_1039597All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea605Open in IMG/M
3300008919|Ga0103484_1012477All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea542Open in IMG/M
3300008935|Ga0103738_1034818All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea697Open in IMG/M
3300008958|Ga0104259_1008402All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea924Open in IMG/M
3300009006|Ga0103710_10074239All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea812Open in IMG/M
3300009026|Ga0102829_1296080All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea538Open in IMG/M
3300009159|Ga0114978_10304162All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea975Open in IMG/M
3300009187|Ga0114972_10721211All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea550Open in IMG/M
3300009268|Ga0103874_1001827All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1031Open in IMG/M
3300009432|Ga0115005_11616991All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea532Open in IMG/M
3300009433|Ga0115545_1186779All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea711Open in IMG/M
3300009436|Ga0115008_10630658All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea774Open in IMG/M
3300009441|Ga0115007_10642900All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea708Open in IMG/M
3300009441|Ga0115007_10797543All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea639Open in IMG/M
3300009543|Ga0115099_10565292All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea939Open in IMG/M
3300009593|Ga0115011_12107166All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea517Open in IMG/M
3300009599|Ga0115103_1385833All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea647Open in IMG/M
3300009606|Ga0115102_10081813All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea623Open in IMG/M
3300009679|Ga0115105_10228579All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea777Open in IMG/M
3300010157|Ga0114964_10468658All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea593Open in IMG/M
3300010370|Ga0129336_10432436All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea716Open in IMG/M
3300010981|Ga0138316_10437381All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea612Open in IMG/M
3300010985|Ga0138326_10410331All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea725Open in IMG/M
3300010985|Ga0138326_11206462All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea550Open in IMG/M
3300012408|Ga0138265_1139470All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea839Open in IMG/M
3300012415|Ga0138263_1163904All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea996Open in IMG/M
3300012518|Ga0129349_1185772All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea983Open in IMG/M
3300012528|Ga0129352_10888278All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea530Open in IMG/M
3300012952|Ga0163180_10445688All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea956Open in IMG/M
3300017967|Ga0181590_10506575All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea840Open in IMG/M
3300018601|Ga0188850_1016405All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea688Open in IMG/M
3300018657|Ga0192889_1059329All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia516Open in IMG/M
3300018684|Ga0192983_1007315All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1252Open in IMG/M
3300018692|Ga0192944_1040188All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea678Open in IMG/M
3300018711|Ga0193069_1032485All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia616Open in IMG/M
3300018739|Ga0192974_1013592All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1331Open in IMG/M
3300018739|Ga0192974_1013593All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1331Open in IMG/M
3300018739|Ga0192974_1014674All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1293Open in IMG/M
3300018742|Ga0193138_1041936All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea603Open in IMG/M
3300018743|Ga0193425_1060108All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea537Open in IMG/M
3300018782|Ga0192832_1037274All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea656Open in IMG/M
3300018832|Ga0194240_1030174All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia543Open in IMG/M
3300018871|Ga0192978_1033173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea966Open in IMG/M
3300018874|Ga0192977_1023436All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1187Open in IMG/M
3300018966|Ga0193293_10109601All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea545Open in IMG/M
3300018979|Ga0193540_10181742All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia584Open in IMG/M
3300018979|Ga0193540_10207606All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia537Open in IMG/M
3300018981|Ga0192968_10139193All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea633Open in IMG/M
3300019001|Ga0193034_10074769All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea741Open in IMG/M
3300019010|Ga0193044_10225992All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea585Open in IMG/M
3300019031|Ga0193516_10158355All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea763Open in IMG/M
3300019032|Ga0192869_10086582All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1174Open in IMG/M
3300019036|Ga0192945_10065736All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1084Open in IMG/M
3300019039|Ga0193123_10418808All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea524Open in IMG/M
3300019048|Ga0192981_10059185All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1415Open in IMG/M
3300019048|Ga0192981_10088005All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1200Open in IMG/M
3300019048|Ga0192981_10127451All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1005Open in IMG/M
3300019050|Ga0192966_10272430All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea600Open in IMG/M
3300019051|Ga0192826_10198462All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea742Open in IMG/M
3300019055|Ga0193208_10484874All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia648Open in IMG/M
3300019108|Ga0192972_1013059All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1480Open in IMG/M
3300019150|Ga0194244_10006034All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1172Open in IMG/M
3300019150|Ga0194244_10026427All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea822Open in IMG/M
3300019150|Ga0194244_10049645All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea687Open in IMG/M
3300019152|Ga0193564_10223227All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia559Open in IMG/M
3300020183|Ga0194115_10209176All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea955Open in IMG/M
3300020193|Ga0194131_10237133All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea843Open in IMG/M
3300020197|Ga0194128_10349262All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea720Open in IMG/M
3300020546|Ga0208853_1017943All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1412Open in IMG/M
3300020603|Ga0194126_10424044All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea841Open in IMG/M
3300021062|Ga0196974_1040314All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea758Open in IMG/M
3300021091|Ga0194133_10194890All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1364Open in IMG/M
3300021359|Ga0206689_10072419All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea602Open in IMG/M
3300021365|Ga0206123_10128515All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1179Open in IMG/M
3300021376|Ga0194130_10285726All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea924Open in IMG/M
3300021424|Ga0194117_10379779All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea651Open in IMG/M
3300021887|Ga0063105_1052290All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea654Open in IMG/M
3300021942|Ga0063098_1124023All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea600Open in IMG/M
3300021962|Ga0222713_10455544All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea774Open in IMG/M
3300023115|Ga0255760_10360527All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea689Open in IMG/M
3300023180|Ga0255768_10501665All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea614Open in IMG/M
3300025887|Ga0208544_10230071All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea751Open in IMG/M
3300027810|Ga0209302_10072103All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1788Open in IMG/M
3300030702|Ga0307399_10318257All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea744Open in IMG/M
3300030709|Ga0307400_10325601Not Available976Open in IMG/M
3300031602|Ga0307993_1018105All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1774Open in IMG/M
3300031602|Ga0307993_1111580All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea688Open in IMG/M
3300031738|Ga0307384_10170264All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea947Open in IMG/M
3300031738|Ga0307384_10639457All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea512Open in IMG/M
3300031739|Ga0307383_10141574All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1101Open in IMG/M
3300031743|Ga0307382_10265728Not Available768Open in IMG/M
3300032521|Ga0314680_10185595All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1183Open in IMG/M
3300032617|Ga0314683_10532186All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea729Open in IMG/M
3300033572|Ga0307390_10927040All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea551Open in IMG/M
3300034064|Ga0335001_0606926All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea575Open in IMG/M
3300034066|Ga0335019_0665225All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea602Open in IMG/M
3300034066|Ga0335019_0762633All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea549Open in IMG/M
3300034105|Ga0335035_0178932All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1319Open in IMG/M
3300034107|Ga0335037_0689636All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea533Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine34.82%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine16.07%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake6.25%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous6.25%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater4.46%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water3.57%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.68%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.68%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh2.68%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater1.79%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.79%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.79%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.79%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.79%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water1.79%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine1.79%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.89%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.89%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.89%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.89%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.89%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.89%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.89%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.89%
Bay WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Bay Water0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300006164Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNAEnvironmentalOpen in IMG/M
3300006384Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006396Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006402Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300007593Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3EnvironmentalOpen in IMG/M
3300007649Estuarine microbial communities from the Columbia River estuary - metaG 1560A-3EnvironmentalOpen in IMG/M
3300008508Freshwater microbial communities from catchments in Singapore - Site BIEnvironmentalOpen in IMG/M
3300008835Eukaryotic communities of water from the North Atlantic ocean - ACM44EnvironmentalOpen in IMG/M
3300008919Microbial communities of nutrient treated water from Blanes Bay, Barcelona, Spain - NA1EnvironmentalOpen in IMG/M
3300008935Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3AEnvironmentalOpen in IMG/M
3300008958Marine microbial communities from eastern North Pacific Ocean - P1 particle-associatedEnvironmentalOpen in IMG/M
3300009006Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_E2EnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009187Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaGEnvironmentalOpen in IMG/M
3300009268Eukaryotic communities of water from the North Atlantic ocean - ACM43EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010157Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaGEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300012408Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012518Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012528Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018601Metatranscriptome of marine microbial communities from Baltic Sea - GS679_3p0_dTEnvironmentalOpen in IMG/M
3300018657Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000705 (ERX1789382-ERR1719418)EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018711Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_143 - TARA_N000003139 (ERX1782287-ERR1712099)EnvironmentalOpen in IMG/M
3300018739Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789514-ERR1719246)EnvironmentalOpen in IMG/M
3300018742Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000534 (ERX1789653-ERR1719224)EnvironmentalOpen in IMG/M
3300018743Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002293 (ERX1782423-ERR1712174)EnvironmentalOpen in IMG/M
3300018782Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000570 (ERX1782313-ERR1712019)EnvironmentalOpen in IMG/M
3300018832Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000852 (ERX1782372-ERR1712031)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018966Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001614 (ERX1809469-ERR1739845)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018981Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782157-ERR1712238)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019039Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782333-ERR1712137)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019055Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000073 (ERX1782414-ERR1711963)EnvironmentalOpen in IMG/M
3300019108Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001017 (ERX1809742-ERR1740135)EnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300019152Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_150 - TARA_N000002717EnvironmentalOpen in IMG/M
3300020183Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surfaceEnvironmentalOpen in IMG/M
3300020193Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120mEnvironmentalOpen in IMG/M
3300020197Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65mEnvironmentalOpen in IMG/M
3300020546Freshwater microbial communities from Lake Mendota, WI - 03OCT2011 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020603Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015035 Kigoma Deep Cast 150mEnvironmentalOpen in IMG/M
3300021062Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10-13CEnvironmentalOpen in IMG/M
3300021091Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40mEnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021376Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surfaceEnvironmentalOpen in IMG/M
3300021424Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surfaceEnvironmentalOpen in IMG/M
3300021887Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021942Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-61M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300023115Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaGEnvironmentalOpen in IMG/M
3300023180Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaGEnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031602Marine microbial communities from Ellis Fjord, Antarctic Ocean - #260EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032617Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300034064Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054EnvironmentalOpen in IMG/M
3300034066Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087EnvironmentalOpen in IMG/M
3300034105Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127EnvironmentalOpen in IMG/M
3300034107Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
B570J40625_10036896113300002835FreshwaterLFRNNYATFQEIKTKTITVSASGNRGDNKRGGDSKKAKLFITLKRSPEFFENMKKFNEIREENEKTASKLQEETKDHK*
Ga0063356_10575858413300004463Arabidopsis Thaliana RhizosphereLFIFARNNYATFKEVKTRTITVSGDRGDSKKAKLFITLKRSPQFFENMAKFNKIREENEAMAKKTEETPK*
Ga0078894_1157048613300005662Freshwater LakeLLFRNQYATFLEIKTKTISVQGNKGDSKKAKLFITLKRSKDFFENMEKFNKVREENEALKKQTEATKE*
Ga0075441_1007040423300006164MarineVFSNKYATFKEIRTETITVAATNNRGDSKKAKLFITLSRSEDFFENMKKFNDIREENERAASKIQEDARDSRNN*
Ga0075516_122194813300006384AqueousNYATFMEIRTKTITVQASNNRGDSKKAKLFITLKRGPEFFENMKKFNEIREENEKTASKLQEESSKEKAQ*
Ga0075493_152388713300006396AqueousIAAENLVRNKYATFHEIRTETITVQASNNRGDSKKAKLFITLRRSADFFENMKKFNEIREENEKTANKIQEESKEPKTN*
Ga0075511_141409713300006402AqueousASFKEIRTETITVQTSNNRGDSKKAKLFITLKRSAEFFDNMKKFNEIREENEKTASKIQEDAKEQ*
Ga0075472_1058814213300006917AqueousCRNNYATFQEIRTKTITVQASGNRADAKRGDSKKAKLFITLKRSPNFFENMKKFNEIREENEKAASKLQEESKDHK*
Ga0102918_106383623300007593EstuarineVFFCRNKYAAFKEIRTETITVQASNNRGDSKKAKLFITLERSADFFENMKKFNEIREENEKTANKIQEDSKEQKTN*
Ga0102912_103862913300007649EstuarineVFFCRNKYATFKEIRTETITVQASNNRGDSKKAKLFITLERSADFFENMKKFNEIREENEKTANKIQEDSKEQKTN*
Ga0110932_116365813300008508FreshwaterMLFSYRNNYATFQEIKTKTITVQGNRGDSKKAKLFITLKRRPEFFENMEKFNKIREENEAQKKKTEEATKE*
Ga0103883_101797113300008835Surface Ocean WaterVCVRNNYASFSEIKTKTITVQASNNRGDSKKAKLFITLKRSPDFFDNMKKFNEIREENEKKASSIEDNKKAE*
Ga0103883_102637313300008835Surface Ocean WaterVCRNQYASFKEIRTETITVQTSNNRGDSKKAKLFITLKRSAEFFDNMKKFNEIREENEKTATKIQEDAKDQH*
Ga0103883_103959713300008835Surface Ocean WaterFKEIRTKTITVQASNQARGDSKKAKLFITLERGPDFFENMKKFNEIREENEKTATKLQEESNQ*
Ga0103484_101247713300008919Bay WaterFKEIRAETITVAATNNRGDSKKAKLFITLSRSEDFFENMKKFNDIREENERAASKIQEDARDSKNN*
Ga0103738_103481813300008935Ice Edge, Mcmurdo Sound, AntarcticaMFVRNNYASFSEIKTKTITVQASNNRGDSKKAKLFITLKRSPEFFENMKKFNEIREENERLAAKNSTEETNKD*
Ga0104259_100840223300008958Ocean WaterLQQKTWSGKCPIVFFARRNNYASFQEIKTKTITVQASNNRGDSKKAKLFITLKKSPEFEENMKRFNEIRDENERKASTLAEER*
Ga0103710_1007423913300009006Ocean WaterLLCRNQYASFKEIRTETITVQTSNNRGDSKKAKLFITLKRSAEFFDNMKKFNEIREENEKTASKIQGDATKDQ*
Ga0102829_129608013300009026EstuarineYLRRVITLPFLRNNYATFKQIRTRTITVQGPRGDRDSKKAKLFITLQRGPDFFENMKKFNEIREENERLASKTTGEEKPTEQK*
Ga0114978_1030416213300009159Freshwater LakeVCFCRNKYATFKEIRTETITVQASNNRGDSKKAKLFITLQRSADFFENMKKFNEIREENEKTANKIQEDSKEQKTN*
Ga0114972_1072121113300009187Freshwater LakeLIRNNYAIFQEIKTKTISVQSTKEENNGGRESKKAKLFITLRRSPDFFENMEKFNKIREENEAKKAEEGAT*
Ga0103874_100182713300009268Surface Ocean WaterVCVRNNYASFSEIKTKTITVQASNNRGDSKKAKLFITLKRSPEFFENMKKFNEIREENEKKASTLAEERKTPQ*
Ga0115005_1161699113300009432MarineVSRNNYATFQEIKTKTITVQASNNRGDSKKAKLFITLKRSPEFFENMKRFNEIREENEKKANTLAEERKSATTEQ*
Ga0115545_118677923300009433Pelagic MarineVYRNNYASFAEIKTKTITVQASNNRGDSKKAKLFITLKRSPDFFENMKKFNDIREENEKKASALTE
Ga0115008_1063065813300009436MarineVSRNNYATFQELKTKTITVQATNNRGDSKKAKLFITLKRSPEFFENMKRFNEIREENEKKANTLAEERKTATDQQ*
Ga0115007_1064290023300009441MarineMIFYSRNNYATFKEIKTKTITVQGSRGDSKKAKLFITLSRSEDFFENMKKFNDIREENEKLQG*
Ga0115007_1079754313300009441MarineYLSRNNYATFKEIKTKTITVQGSRGDSKKAKLFITLSRSENFFENMKKFNEIREENEKL*
Ga0115099_1056529213300009543MarineVIAAENLVRNNYATFQEIKTKTITVQASNNRGDSKKAKLFITLKRSPEFFENMKRFNEIREENEKKANTLAEERKTAADQQ*
Ga0115011_1210716613300009593MarineMFTYLFNVSRNNYATFQEIKTKTITVQASNNRGDSKKAKLFITLKRSPEFFENMKRFNEIREENEKKANTLAEERKNSGSQQ*
Ga0115103_138583313300009599MarineVIAAENLVRNNYATFQEIKTKTITVQASNNRGDSKKAKLFITLKRSPEFFENMKRFNEIREENEKKANTLAEERKSTTGQQ*
Ga0115102_1008181323300009606MarineVIASENLVRNNYATFKEIKTRTITVQGPRGDSKKAKLFITLQRGPDFFENMKKFNEIREENERLAAKQQQETPADDKK*
Ga0115105_1022857913300009679MarineVIAAENLVRNNYATFQEIKTKTITVQASNNRGDSKKAKLFITLKRSPEFFENMKRFNEIREENEKKASTLAEERKSATQEQ*
Ga0114964_1046865813300010157Freshwater LakeLTIFRNNYASFKEIRTETITVQSSNNKGDSKKAKLFITLKRSAEFFDNMKKFNEIREENEKNANKIQEESKEQKTN*
Ga0129336_1043243613300010370Freshwater To Marine Saline GradientLASLTRCRNNYATFQEIRTKTITVQASGNRADAKRGDSKKAKLFITLKRSPNFFENMKKFNEIREENEKAASKLQEESKDHK*
Ga0138316_1043738123300010981MarineSTSVIAAENLVRNNYATFQKIQTKTITVQASNNRGDSKKAKLFITLKRSPEFFENMKKFNEIREENEKKANTLAEERKTAATQE*
Ga0138326_1041033123300010985MarineVIAAENLVRNNYATFQKIQTKTITVQASNNRGDSKKAKLFITLKRSPEFFENMKKFNEIREENEKKANTLAEERKTAATQE*
Ga0138326_1120646213300010985MarineNNYASFQEIKTKTITVQASNNRGDSKKAKLFITLKRSPEFFENMKRFNEIREENEKKATTLAEERKAAQ*
Ga0138265_113947013300012408Polar MarineVRNNYASFSEIKTKTITVQASNNRGDSKKAKLFITLKRSPEFFENMKKFNEIREENEKKASTLAEERKTTQ*
Ga0138263_116390413300012415Polar MarineMQAGLIEYCTYLFLLMFVRNNYASFSEIKTKTITVQASNNRGDSKKAKLFITLKRSPEFFENMKKFNEIREENEKKASTLAEERKTTQ*
Ga0129349_118577213300012518AqueousVIAAENLVRNNYATFQKIQTKTITVQASNNRGDSKKAKLFITLKRSPEFFENMKRFNEIREENEKKANTLAEERKTAAGQQ*
Ga0129352_1088827813300012528AqueousSVIAAENLVRNNYATFQKIQTKTITVQASNNRGDSKKAKLFITLKRSPEFFENMKRFNEIREENEKKANTLAEERKTAAGQQ*
Ga0163180_1044568813300012952SeawaterVSRNNYATFQEIKTKTITVQASNNRGDSKKAKLFITLKRSPEFFENMKRFNEIREENEKKANTLAEERKNATGQQ*
Ga0181590_1050657523300017967Salt MarshVHLRGKGCLPFCRNQYASFKEIRTETITVQTSNNRGDSKKAKLFITLKRSAEFFDNMKKFNEIREENEKTATKIQEDAKDQH
Ga0188850_101640513300018601Freshwater LakeVCRNQYATFKSIRTETITVQTSNNRGDSKKAKLFITLKRSAQFFENMKKFNEIREENEKTANKIQEDSKQQ
Ga0192889_105932913300018657MarineENLVRNNYATFQEIRTKTITVQASNNRGDSKKAKLFITLKRSPDFFENMRKFNEIREENEKNASKLQEENKDAAA
Ga0192983_100731513300018684MarineMFVRNNYASFSEIKTKTITVQASNNRGDSKKAKLFITLKRSPEFFENMKKFNEIREENEKKASTLAEERKTTQ
Ga0192944_104018813300018692MarineMFVRNNYASFSEIKTKTITVQASNNRGDSKKAKLFITLKRSPEFFENMKKFNEIREENEKKASTLAEERKTTPQ
Ga0193069_103248513300018711MarineRNNYATFQEIRTKTITVQASNNRGDSKKAKLFITLKRSPDFFENMRKFNEIREENEKNASKLQEENKDAAA
Ga0192974_101359223300018739MarineLQLKTVFCARRNNYASFQEIKTKTITVQASNNRGDSKKAKLFITLKKSPEFEENMKRFNEIRDENERKASTLAEER
Ga0192974_101359323300018739MarineLQQKTVFCARRNNYASFQEIKTKTITVQASNNRGDSKKAKLFITLKKSPEFEENMKRFNEIRDENERKASTLAEER
Ga0192974_101467433300018739MarineLYRNNYATFSEIRTKTITVQASNNRGDSKKAKLFITLKRSPDFFENMRKFNEIREENEKTANKMQEESKDVVAAE
Ga0193138_104193613300018742MarineNLVRNQYASFKEIRTETITVQTSNNRGDSKKAKLFITLKRSAEFFDNMKKFNEIREENEKTATKIQEDAKDQH
Ga0193425_106010813300018743MarineASENLVRNNYATFQEIRTKTITVQASNNRGDSKKAKLFITLKRSPDFFENMKKFNEIREENEKTANKLQEESKDQKTN
Ga0192832_103727413300018782MarineSVIASENLVRNNYATFQEIRTKTITVQASNNRGDSKKAKLFITLKRSPDFFENMKKFNEIREENEKTANKLQEESKDQKTN
Ga0194240_103017423300018832MarineVIASENLVRNNYATFQEIRTKTITVQASNNRGDSKKAKLFITLKRSPDFFENMKKFNEIREENEKTASKLQEESKEPKTN
Ga0192978_103317313300018871MarineVIAAENLVRNNYATFQEIKTKTITVQASNNRGDSKKAKLFITLKRSPEFFENMKRFNEIREENEKKANTLAEERKSTSGQQ
Ga0192977_102343613300018874MarineLPPLVVVSYGLFLLMFVRNNYASFSEIKTKTITVQASNNRGDSKKAKLFITLKRSPEFFENMKKFNEIREENEKKASTLAEERKTTQ
Ga0193293_1010960113300018966MarineTWATSVIASENLVRNNYATFQEIRTKTITVQASNNRGDSKKAKLFITLKRSPDFFENMKKFNEIREENEKTANKLQEESKDQKTN
Ga0193540_1018174213300018979MarineNYATFQEIRTKTITVQASNNRGDSKKAKLFITLKRSPDFFENMKKFNEIREENEKTASKLQEESKEPKTN
Ga0193540_1020760613300018979MarineNYATFQEIRTKTITVQASNNRGDSKKAKLFITLKRSPDFFENMKKFNEIREENEKTANKLQEESKEPKTN
Ga0192968_1013919313300018981MarineLVRNNYATFQEIRTKTITVQASNNRGDSKKAKLFITLKRSPDFFENMRKFNEIREENEKNAVKLQEESKDTAAAQ
Ga0193034_1007476913300019001MarineNLVRNNYASFQEIKTKTITVQASNNRGDSKKAKLFITLKRSPEFFENMKRFNEIREENEKKASTLAEERKSTQ
Ga0193044_1022599213300019010MarineFKEIRTETITVQTSNNRGDSKKAKLFITLKRSAEFFDNMKKFNEIREENEKTASKIQEDAKEQ
Ga0193516_1015835513300019031MarineHGAAENLVRNNYASFQEIKTKTITVQASNNRGDSKKAKLFITLKRSPEFFENMKRFNEIREENEKKASTLAEERKAAQ
Ga0192869_1008658223300019032MarineLNLNLTLSCRNQYASFKEIRTETITVQTSNNRGDSKKAKLFITLKRSAEFFDNMKKFNEIREENEKTATKIQEDAKDQN
Ga0192945_1006573613300019036MarineLLMFVRNNYASFSEIKTKTITVQASNNRGDSKKAKLFITLKRSPEFFENMKKFNEIREENEKKASTLAEERKTTPQ
Ga0193123_1041880813300019039MarineEIRTKTITVQASNNRGDSKKAKLFITLKRSPDFFENMKKFNEIREENEKTANKLQEESKEPKTN
Ga0192981_1005918523300019048MarineVFSNKYATFKEIRTETITVAATNNRGDSKKAKLFITLSRSEDFFENMKKFNDIREENERAASKIQEDARDSRNN
Ga0192981_1008800513300019048MarineVKLSAALFEHVSRNNYATFQEIKTKTITVQASNNRGDSKKAKLFITLKRSPEFFENMKRFNEIREENEKKANTLAEERKSTSGQQ
Ga0192981_1012745113300019048MarineLNLTLSCRNQYASFKEIRTETITVQTSNNRGDSKKAKLFITLKRSAEFFDNMKKFNEIREENEKTATKIQEDAKDQN
Ga0192966_1027243013300019050MarineTWDATFKEIRTETITVAATNNRGDSKKAKLFITLSRSDDFFENMKKFNDIREENERAASKIQEDTRDSRNN
Ga0192826_1019846213300019051MarineQEIRTKTITVQASNNRGDSKKAKLFITLKRSPQFFENMRKFNEIREENEKNANKLQEESKDAATAQ
Ga0193208_1048487423300019055MarineMGSVIASENLVRNNYATFQEIRTKTITVQASNNRGDSKKAKLFITLKRSPDFFENMRKFNEIREENEKNASKLQEENKDAAA
Ga0192972_101305923300019108MarineLDCFYRNNYATFQEIRTKTITVQASNNRGDSKKAKLFITLKRSPDFFENMRKFNEIREENEKNAVKLQEESKDTATAQ
Ga0194244_1000603423300019150MarineVFSNKYATFKEIRTETITVAATNNRGDSKKAKLFITLSRSDDFFENMKKFNDIREENERAASKIQEDAKETRNN
Ga0194244_1002642713300019150MarineFVRNNYASFQEIKTKTITVQASNNRGDSKKAKLFITLKRSPEFFENMKRFNEIREENEKKASSLAEERKASQ
Ga0194244_1004964513300019150MarineSENLVRNNYATFQEIRTKTITVQASNNRGDSKKAKLFITLKRGPDFFENMKKFNEIREENEKTANKLQQESDKEKTQ
Ga0193564_1022322723300019152MarineENLVRNNYATFQEIRTKTITVQASNNRGDSKKAKLFITLKRSPDFFENMKKFNEIREENEKTASKLQEESKEPKTN
Ga0194115_1020917613300020183Freshwater LakeLIIRNNYATFKEIKTKTISVQGQRGESKKAKLFITLSRGPDFFENMKKFSEIKEENE
Ga0194131_1023713313300020193Freshwater LakeRNKYATFKEIRTETITVQASNNRGDSKKAKLFITLQRSADFFENMKKFNEIREENEKTANKIQEDSKEQKTN
Ga0194128_1034926213300020197Freshwater LakeVIINFLIIRNNYATFKEIKTKTISVQGQRGESKKAKLFITLSRGPDFFENMKKFSEIKEENE
Ga0208853_101794313300020546FreshwaterLFRNNYATFQEIKTKTITVSASGNRGDNKRGGDSKKAKLFITLKRSPEFFENMKKFNEIREENEKTASKLQEETKDHK
Ga0194126_1042404423300020603Freshwater LakeFRNKYATFKEIRTETITVQASNNRGDSKKAKLFITLQRSADFFENMKKFNEIREENEKTANKIQEDSKEQKTN
Ga0196974_104031423300021062SoilLLFRNKYATFKEIKTKTITVSGNRGDSKKAKLFITLQRSPDFFENMKKFNEIREENERKAKALEETKQ
Ga0194133_1019489013300021091Freshwater LakeLHGQNLRVIFRNKYATFKEIRTETITVQASNNRGDSKKAKLFITLQRSADFFENMKKFNEIREENEKTANKIQEDSKEQKTN
Ga0206689_1007241913300021359SeawaterENLVRNNYATFSEIRTKTITVQASNNRGDSKKAKLFITLTRSPDFFENMKKFNEIREENEKTANKLQEETTDQKTN
Ga0206123_1012851523300021365SeawaterVSRNNYATFQEIKTKTITVQASNNRGDSKKAKLFITLKRSPEFFENMKRFNEIREENEKKANTLAEERKSTSGQQ
Ga0194130_1028572613300021376Freshwater LakeIRFEIVXKAGLSHFGALFYPMKTDVFFRNKYATFKEIRTETITVQASNNRGDSKKAKLFITLERSADFFENMKKFNEIREENEKTANKIQEDSKEQKTNXDXER
Ga0194117_1037977913300021424Freshwater LakeALFYPMKTDVFFRNKYATFKEIRTETITVQASNNRGDSKKAKLFITLERSADFFENMKKFNEIREENEKTANKIQEDSKEQKTN
Ga0063105_105229013300021887MarineRNNYATFQEIKTKTITVQASNNRGDSKKAKLFITLKRSPEFFENMKRFNEIREENEKKANTLAEERKTATDQQ
Ga0063098_112402313300021942MarineFLLMFVRNNYASFSEIKTKTITVQASNNRGDSKKAKLFITLKRSPEFFENMKKFNEIREENEKKASTLAEERKNTE
Ga0222713_1045554413300021962Estuarine WaterVSYSNNYATFKEIRTRTITVQGPRGDSKKAKLFITLSRGPDFFENMKKFNEIREENERLAAKGDTP
Ga0255760_1036052713300023115Salt MarshYASFKEIRTETITVQTSNNRGDSKKAKLFITLKRSAEFFDNMKKFNEIREENEKTATKIQEDAKDQH
Ga0255768_1050166513300023180Salt MarshPVHLRGKGCLPFCRNQYASFKEIRTETITVQTSNNRGDSKKAKLFITLKRSAEFFDNMKKFNEIREENEKTATKIQEDAKDQH
Ga0208544_1023007113300025887AqueousMDRGGLFENWLLTQVFFFFRNKYATFHEIRTETITVQASNNRGDSKKAKLFITLRRSADFFENMKKFNEIREENEKTANKIQEESKEPKTN
Ga0209302_1007210313300027810MarineVSRNNYATFQEIKTKTITVQASNNRGDSKKAKLFITLKRSPEFFENMKRFNEIREENEKKANTLAEERKSATTEQ
Ga0307399_1031825723300030702MarineLVRNNYATFQEIKTKTITVQASNNRGDSKKAKLFITLKRSPEFFENMKRFNEIREENEKKASTLAEERKSVVEEQ
Ga0307400_1032560113300030709MarineRNNYASFQEIKTKTITVQASNNRGDSKKAKLFITLKKSPEFEENMKRFNEIRDENERKASTLAEER
Ga0307993_101810513300031602MarineLSRNNYATFQEIKTKTITVQASNNRGDSKKAKLFITLKRSPEFFENMKKFNEIREENEKKASTLAEERKTATQEQ
Ga0307993_111158013300031602MarineLLLRNNYATFSEIRTKTITVQASNNRGDSKKAKLFITLTRSPDFFENMKKFNEIREENEKTANKLQEESKDEKTN
Ga0307384_1017026413300031738MarineAVSTSVIAAENLVRNNYASFQEIKTKTITVQASNNRGDSKKAKLFITLKRSPEFFENMKRFNEIREENEKKATTLAEERKATQ
Ga0307384_1063945713300031738MarineLVTLIVSSSLFLLMFVRNNYASFSEIKTKTITVQASNNRGDSKKAKLFITLKRSEKFFENMKKFNEIREENEKKASTLAEERKTTQ
Ga0307383_1014157413300031739MarineVIAAENLVRNNYASFQEIKTKTITVQASNNRGDSKKAKLFITLKRSPEFFENMRRFNEIREENEKKASSIAEERKTAQ
Ga0307382_1026572813300031743MarineTSVIAAENLVRNNYASFQEIKTKTITVQASNNRGDSKKAKLFITLKKSPEFEENMKRFNEIRDENERKASTLAEER
Ga0314680_1018559523300032521SeawaterVCVRNNYASFSEIKTKTITVQASNNRGDSKKAKLFITLKRSPEFFENMKKFNEIREENEKKASTLAEERKTTQ
Ga0314683_1053218613300032617SeawaterSFSEIKTKTITVQASNNRGDSKKAKLFITLKRSPEFFENMKKFNEIREENEKKASTLAEERKTTQ
Ga0307390_1092704013300033572MarineVSTSVIAAENLVRNNYATFQEIKTKTITVQASNNRGDSKKAKLFITLKRSPEFFENMKRFNEIREENEKKANTLAEERKSTSGQQ
Ga0335001_0606926_255_4853300034064FreshwaterVFFCRNKYATFKEIRTETITVQASNNRGDSKKAKLFITLERSADFFENMKKFNEIREENEKTANKIQEDSKEQKTN
Ga0335019_0665225_117_3263300034066FreshwaterVLLFRNQYATFLEIKTKTISVQGNKGDSKKAKLFITLKRSKDFFENMEKFNKVREENEALKKQTEATKE
Ga0335019_0762633_361_5493300034066FreshwaterMFILIQNLSYRNNYATFKEIKTKTITVNGTRGESKKAKLFITLQRGPDFFENMRKFSEIKEEN
Ga0335035_0178932_660_8903300034105FreshwaterLFSRNKYASFKSIRTETINVQASTNNRNDSKKAKLFITLQRSPEFFENMKKFNEIREENEKTANKIQEDSKEQKTN
Ga0335037_0689636_2_2053300034107FreshwaterLFRNNYATFQEIKTKTITVSASGNRGDNKRGGDSKKAKLFITLKRSPEFFENMKKFNEIREENEKTAS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.