NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300008508

3300008508: Freshwater microbial communities from catchments in Singapore - Site BI



Overview

Basic Information
IMG/M Taxon OID3300008508 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0118189 | Gp0131422 | Ga0110932
Sample NameFreshwater microbial communities from catchments in Singapore - Site BI
Sequencing StatusPermanent Draft
Sequencing CenterSingapore Centre on Environmental Life Sciences Engineering (SCELSE)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size101759895
Sequencing Scaffolds10
Novel Protein Genes11
Associated Families11

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1
Not Available1
All Organisms → cellular organisms → Bacteria → Proteobacteria1
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea3
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameFreshwater Microbial Communities From Catchments In Singapore
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Microbial Communities From Catchments In Singapore

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater biome → drainage basin → fresh water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationSingapore
CoordinatesLat. (o)1.3Long. (o)103.8Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000237Metagenome / Metatranscriptome1498Y
F000331Metagenome / Metatranscriptome1285Y
F001506Metagenome / Metatranscriptome681Y
F004905Metagenome / Metatranscriptome419Y
F034767Metagenome / Metatranscriptome174Y
F039134Metagenome / Metatranscriptome164N
F041736Metagenome / Metatranscriptome159Y
F044442Metagenome / Metatranscriptome154Y
F067528Metagenome / Metatranscriptome125Y
F071293Metagenome / Metatranscriptome122Y
F084728Metagenome / Metatranscriptome112Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0110932_1007427All Organisms → cellular organisms → Bacteria1393Open in IMG/M
Ga0110932_1034898Not Available1091Open in IMG/M
Ga0110932_1035234All Organisms → cellular organisms → Bacteria → Proteobacteria1276Open in IMG/M
Ga0110932_1036292All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea511Open in IMG/M
Ga0110932_1036315All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta542Open in IMG/M
Ga0110932_1051836All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana708Open in IMG/M
Ga0110932_1144214All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea771Open in IMG/M
Ga0110932_1161531All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes638Open in IMG/M
Ga0110932_1163658All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea670Open in IMG/M
Ga0110932_1182712All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage595Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0110932_1007427Ga0110932_10074271F001506MNRILYENRCRCNEDFSITKKRKSITRSEGKPLQYPKPNEITSQTFQIKYEKKLSSTAKVILNSFQNKYIYYAIDDILYSLKGNSIERDNLLAILYSPVLSLQNHFSINFFDIWIREIYIEEIRQTNKFLTNDSQTSELFSYITIKLFYKTRVPVKKQESLWYIFLLLKKCICIYFLIY*
Ga0110932_1009206Ga0110932_10092061F000237DTIFVLSYLHILKKIYIKNYITAESDG*ILGGYAFF*FHYIVALGISLSATHLSDLTLTIIANIY*SVFNNIYKTYYIIFTNKHLNIDQMTRLMILHYFTP*YYLYLIQLHVLFCHES*DSDSGESTYEDKSGSYIS*FYDAFLKEIQDA*Y*TMFVFIYF*LHHFNPSTVNYFFFER*NIAELDEIRFYGVAPH*YFRPLMGLLVISPTHYEGLM*MGLFFILLAFLPIIYN*YNVYNKHIPTIPMQNSLIQTFAFITFMMSLFCSASMLPCGRYYYEPEGGYVGNP*VKFSYQYIYLYMAWFVHHLDLIDHYIFQFFQTFIRKCLKLYKKNINITKNTLSKFINFSNINKNYYNIV
Ga0110932_1034898Ga0110932_10348984F041736LQAHPDNEISTQEKDMNLKSQSMNFVMETMQDVLKKWTLDTLEGQDTSQHINPSAPMIVQVGDYGYEVQSCGGDGDIEGFVIMCKPDPVCKWDGLEFIRLE*
Ga0110932_1035234Ga0110932_10352341F067528LFYLDFFELAQSGGSEQNSVLIALKPLYEGAFFKLWSGADREKVNQINSLSAAFERLKI*
Ga0110932_1036292Ga0110932_10362921F071293MVYKIRNKGFNNTAAALNPRVHPAKKTKIHADLTRYITMQVQITRFTGMRILHNYRNISRATKQFLMGDKILEQLMILTIKEHYFRPMYYRSPIENSFYLGRSLADLTDRHYSLFANNQHPLQLYVYEEYNKF
Ga0110932_1036315Ga0110932_10363151F034767MFGSKIVYDILRGINATVWGGVDGAEKVAKIVKTGLSGADVLIGTSHTLEDASCGDYVCATLDVIGSVSSAVGLVLGNLPTTKSYTSITGSVTVCCRTVRWYCKKYGTFWGCVASVGTGAKEVFKFKIQNPN*
Ga0110932_1051836Ga0110932_10518361F000331VHQTIMAMLRTSEIDMAETVTESDIADFLTYAAWAVRSTYHTVLKTSPGAAIFGRDMLFDVPFLADWKKIGEYRQKQTDKNTSNENKGRKDWDYQPGDKVLVMKDGILRKSESRYGSEPWTITSVHTNGTIRIQCGTKSERLNIRRVTPYFE*
Ga0110932_1144214Ga0110932_11442141F004905LGLLFIRELPIKNFYARCWLAYAWIIYFVTRGLGRGLRHSRPIVMYNHALHAKSLVNYPDLFWWNLTKILPKNPPVPDAHREWRTRQTPVYHQYHRTTYRYRHRKPRYVPWDGSQNQPVMPYMVDIGTE
Ga0110932_1161531Ga0110932_11615311F039134QLQSFKTVVTKSPKQRYEIEAYNEYLLLTNASVLPIGTRIISDTNSLEITAAQNALEGLEEFSGLIAIELPEKVDTYPIIEFIQIVKE*
Ga0110932_1163658Ga0110932_11636581F084728MLFSYRNNYATFQEIKTKTITVQGNRGDSKKAKLFITLKRRPEFFENMEKFNKIREENEAQKKKTEEATKE*
Ga0110932_1182712Ga0110932_11827121F044442NLTLAQKRFVVAAIESNPAYKKNPQITLKECSALYDAVRATRSGAKGEKIGYPNWLFAANKVERGVYQLPIPTATELSAYQQELDAKLNPVAKAKAKVVKLQSAKAVKPKTKAQTKAPAPQAEDTAEESIQGSRLNKIIAESEPFDQDVEDFNAILRENGIEV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.