NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F068085

Metagenome Family F068085

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F068085
Family Type Metagenome
Number of Sequences 125
Average Sequence Length 58 residues
Representative Sequence MIVWKYILLFTCLGIGVALCVGAISILRSPPDNGPPAWFAAAFGAMFFWGAFALARWRLQ
Number of Associated Samples 115
Number of Associated Scaffolds 125

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 71.77 %
% of genes near scaffold ends (potentially truncated) 65.60 %
% of genes from short scaffolds (< 2000 bps) 82.40 %
Associated GOLD sequencing projects 107
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (54.400 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(17.600 % of family members)
Environment Ontology (ENVO) Unclassified
(38.400 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(47.200 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: Yes Secondary Structure distribution: α-helix: 55.68%    β-sheet: 0.00%    Coil/Unstructured: 44.32%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 125 Family Scaffolds
PF13581HATPase_c_2 8.80
PF02518HATPase_c 4.80
PF07568HisKA_2 4.00
PF13472Lipase_GDSL_2 3.20
PF13545HTH_Crp_2 3.20
PF02566OsmC 3.20
PF05981CreA 2.40
PF01152Bac_globin 2.40
PF00072Response_reg 1.60
PF00027cNMP_binding 1.60
PF08448PAS_4 1.60
PF03401TctC 0.80
PF04392ABC_sub_bind 0.80
PF13458Peripla_BP_6 0.80
PF05378Hydant_A_N 0.80
PF07369DUF1488 0.80
PF00140Sigma70_r1_2 0.80
PF03734YkuD 0.80
PF04226Transgly_assoc 0.80
PF13396PLDc_N 0.80
PF06823DUF1236 0.80
PF00296Bac_luciferase 0.80
PF13936HTH_38 0.80
PF09939DUF2171 0.80
PF13531SBP_bac_11 0.80
PF07883Cupin_2 0.80
PF12244DUF3606 0.80

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 125 Family Scaffolds
COG3920Two-component sensor histidine kinase, HisKA and HATPase domainsSignal transduction mechanisms [T] 4.00
COG1764Organic hydroperoxide reductase OsmC/OhrADefense mechanisms [V] 3.20
COG1765Uncharacterized OsmC-related proteinGeneral function prediction only [R] 3.20
COG2346Truncated hemoglobin YjbIInorganic ion transport and metabolism [P] 2.40
COG3045Periplasmic catabolite regulation protein CreA (function unknown)Signal transduction mechanisms [T] 2.40
COG0145N-methylhydantoinase A/oxoprolinase/acetone carboxylase, beta subunitAmino acid transport and metabolism [E] 1.60
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.80
COG1376Lipoprotein-anchoring transpeptidase ErfK/SrfKCell wall/membrane/envelope biogenesis [M] 0.80
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.80
COG2261Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein familyGeneral function prediction only [R] 0.80
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.80
COG3034Murein L,D-transpeptidase YafKCell wall/membrane/envelope biogenesis [M] 0.80
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.80


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms54.40 %
UnclassifiedrootN/A45.60 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459010|GIO7OMY02JW7P9All Organisms → cellular organisms → Bacteria → Proteobacteria520Open in IMG/M
2228664022|INPgaii200_c0964052Not Available641Open in IMG/M
3300000559|F14TC_100781478All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1455Open in IMG/M
3300000787|JGI11643J11755_11807868All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium uaiense601Open in IMG/M
3300000891|JGI10214J12806_11155804All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1792Open in IMG/M
3300001979|JGI24740J21852_10037388Not Available1499Open in IMG/M
3300002128|JGI24036J26619_10015087All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1408Open in IMG/M
3300004114|Ga0062593_100003249All Organisms → cellular organisms → Bacteria → Proteobacteria6207Open in IMG/M
3300004156|Ga0062589_100003518All Organisms → cellular organisms → Bacteria → Proteobacteria5269Open in IMG/M
3300004479|Ga0062595_101107285All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300004479|Ga0062595_102351503Not Available527Open in IMG/M
3300005093|Ga0062594_100000551All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium7151Open in IMG/M
3300005147|Ga0066821_1014660All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium608Open in IMG/M
3300005169|Ga0066810_10032794Not Available937Open in IMG/M
3300005289|Ga0065704_10408768Not Available744Open in IMG/M
3300005328|Ga0070676_10660962Not Available759Open in IMG/M
3300005330|Ga0070690_100806091Not Available728Open in IMG/M
3300005335|Ga0070666_11348131All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium533Open in IMG/M
3300005343|Ga0070687_100468515Not Available841Open in IMG/M
3300005353|Ga0070669_100703136Not Available854Open in IMG/M
3300005354|Ga0070675_100211066All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis1687Open in IMG/M
3300005366|Ga0070659_100789036Not Available825Open in IMG/M
3300005456|Ga0070678_100447036Not Available1131Open in IMG/M
3300005468|Ga0070707_101557681Not Available628Open in IMG/M
3300005518|Ga0070699_101506867Not Available617Open in IMG/M
3300005536|Ga0070697_101319937Not Available644Open in IMG/M
3300005536|Ga0070697_101548143All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium593Open in IMG/M
3300005543|Ga0070672_100517431Not Available1033Open in IMG/M
3300005544|Ga0070686_100612021Not Available859Open in IMG/M
3300005546|Ga0070696_100524496All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales945Open in IMG/M
3300005546|Ga0070696_100528027All Organisms → cellular organisms → Bacteria943Open in IMG/M
3300005563|Ga0068855_101390684All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium uaiense724Open in IMG/M
3300005563|Ga0068855_101654137Not Available654Open in IMG/M
3300005615|Ga0070702_100563744Not Available848Open in IMG/M
3300005842|Ga0068858_100025134All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales5542Open in IMG/M
3300006172|Ga0075018_10542313Not Available611Open in IMG/M
3300006237|Ga0097621_100560828All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1040Open in IMG/M
3300006354|Ga0075021_10005913All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales6457Open in IMG/M
3300006881|Ga0068865_100429530All Organisms → cellular organisms → Bacteria1088Open in IMG/M
3300006903|Ga0075426_10468938Not Available933Open in IMG/M
3300009176|Ga0105242_10357111All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1351Open in IMG/M
3300009545|Ga0105237_12356590All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales542Open in IMG/M
3300010373|Ga0134128_12109696All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300010375|Ga0105239_11005255Not Available959Open in IMG/M
3300010401|Ga0134121_12213293All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300012496|Ga0157353_1001645All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1314Open in IMG/M
3300012884|Ga0157300_1004489All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1486Open in IMG/M
3300012891|Ga0157305_10138881Not Available642Open in IMG/M
3300012901|Ga0157288_10006580All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis1758Open in IMG/M
3300012904|Ga0157282_10019775All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1372Open in IMG/M
3300012908|Ga0157286_10348923All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium558Open in IMG/M
3300012913|Ga0157298_10162087Not Available681Open in IMG/M
3300012941|Ga0162652_100077192Not Available575Open in IMG/M
3300012958|Ga0164299_10271028Not Available1026Open in IMG/M
3300012960|Ga0164301_10132531All Organisms → cellular organisms → Bacteria1493Open in IMG/M
3300012961|Ga0164302_10370335All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium uaiense965Open in IMG/M
3300012984|Ga0164309_11051162Not Available674Open in IMG/M
3300012986|Ga0164304_11510850All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales556Open in IMG/M
3300012987|Ga0164307_11373944All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium593Open in IMG/M
3300013105|Ga0157369_10316232All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1623Open in IMG/M
3300013297|Ga0157378_10838245Not Available947Open in IMG/M
3300013306|Ga0163162_10923012Not Available985Open in IMG/M
3300013307|Ga0157372_10963234All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria989Open in IMG/M
3300014968|Ga0157379_11094038Not Available763Open in IMG/M
3300015371|Ga0132258_10285601All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium4051Open in IMG/M
3300015371|Ga0132258_10585480All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium2800Open in IMG/M
3300015373|Ga0132257_103140827Not Available602Open in IMG/M
3300015374|Ga0132255_100300488All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2310Open in IMG/M
3300018067|Ga0184611_1078492All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1130Open in IMG/M
3300018073|Ga0184624_10455298All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales561Open in IMG/M
3300019356|Ga0173481_10004883All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3548Open in IMG/M
3300019356|Ga0173481_10124814All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1027Open in IMG/M
3300020002|Ga0193730_1093101All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales844Open in IMG/M
3300022892|Ga0247753_1012991All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales876Open in IMG/M
3300025711|Ga0207696_1184856Not Available550Open in IMG/M
3300025907|Ga0207645_10027668All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3660Open in IMG/M
3300025907|Ga0207645_10122500All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1689Open in IMG/M
3300025911|Ga0207654_10414347All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria939Open in IMG/M
3300025917|Ga0207660_10296913Not Available1286Open in IMG/M
3300025926|Ga0207659_10479924Not Available1050Open in IMG/M
3300025930|Ga0207701_10042609All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis4212Open in IMG/M
3300025936|Ga0207670_11805303Not Available520Open in IMG/M
3300025937|Ga0207669_10174554All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1534Open in IMG/M
3300025972|Ga0207668_10118855All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1998Open in IMG/M
3300026035|Ga0207703_12149646All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium534Open in IMG/M
3300026067|Ga0207678_10692549Not Available897Open in IMG/M
3300026075|Ga0207708_10038394All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3647Open in IMG/M
3300026089|Ga0207648_10622276All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium sangaii996Open in IMG/M
3300026095|Ga0207676_11126611All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium uaiense776Open in IMG/M
3300026118|Ga0207675_100616154All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1089Open in IMG/M
3300026142|Ga0207698_10882840Not Available901Open in IMG/M
3300026719|Ga0207438_100257All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium923Open in IMG/M
3300026720|Ga0207440_101874Not Available602Open in IMG/M
3300026769|Ga0207492_100196All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1367Open in IMG/M
3300026779|Ga0207471_104252Not Available528Open in IMG/M
3300026822|Ga0207498_100121All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3451Open in IMG/M
3300026900|Ga0207444_1001041Not Available2022Open in IMG/M
3300026939|Ga0207542_102634Not Available608Open in IMG/M
3300026944|Ga0207570_1007759Not Available750Open in IMG/M
3300027036|Ga0207467_1004335Not Available992Open in IMG/M
3300027407|Ga0207520_101003All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860730Open in IMG/M
3300027425|Ga0207522_100518Not Available976Open in IMG/M
3300027617|Ga0210002_1064750Not Available640Open in IMG/M
3300027665|Ga0209983_1003749All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3220Open in IMG/M
3300027894|Ga0209068_10032817All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2579Open in IMG/M
3300027910|Ga0209583_10565684Not Available573Open in IMG/M
3300028720|Ga0307317_10200555Not Available673Open in IMG/M
3300028755|Ga0307316_10077508All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1142Open in IMG/M
3300028807|Ga0307305_10572666Not Available503Open in IMG/M
3300028811|Ga0307292_10247556Not Available740Open in IMG/M
3300028814|Ga0307302_10360143Not Available718Open in IMG/M
(restricted) 3300031197|Ga0255310_10004678All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3570Open in IMG/M
3300031226|Ga0307497_10108689All Organisms → cellular organisms → Bacteria1093Open in IMG/M
3300031226|Ga0307497_10196378Not Available871Open in IMG/M
(restricted) 3300031248|Ga0255312_1004459All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3327Open in IMG/M
(restricted) 3300031248|Ga0255312_1127360Not Available628Open in IMG/M
3300031854|Ga0310904_10018763All Organisms → cellular organisms → Bacteria → Proteobacteria2996Open in IMG/M
3300031940|Ga0310901_10000853All Organisms → cellular organisms → Bacteria6067Open in IMG/M
3300031944|Ga0310884_10863429Not Available556Open in IMG/M
3300032205|Ga0307472_101110727Not Available749Open in IMG/M
3300032782|Ga0335082_10491129Not Available1090Open in IMG/M
3300032892|Ga0335081_10700216Not Available1229Open in IMG/M
3300033433|Ga0326726_10097569All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2625Open in IMG/M
3300034090|Ga0326723_0591436Not Available513Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil17.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil12.80%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.40%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere5.60%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere4.00%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.20%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere3.20%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.20%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.20%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.40%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.40%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil2.40%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.40%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.40%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.60%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.60%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere1.60%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.60%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.60%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.60%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.60%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.60%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.60%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.80%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.80%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.80%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.80%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.80%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.80%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.80%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.80%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459010Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)EnvironmentalOpen in IMG/M
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300001979Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6Host-AssociatedOpen in IMG/M
3300002128Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005147Soil and rhizosphere microbial communities from Laval, Canada - mgLMCEnvironmentalOpen in IMG/M
3300005169Soil and rhizosphere microbial communities from Laval, Canada - mgHPAEnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012496Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.090610EnvironmentalOpen in IMG/M
3300012884Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2EnvironmentalOpen in IMG/M
3300012891Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012904Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012941Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300022892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S169-409R-5EnvironmentalOpen in IMG/M
3300025711Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026719Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A3-11 (SPAdes)EnvironmentalOpen in IMG/M
3300026720Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A2w-12 (SPAdes)EnvironmentalOpen in IMG/M
3300026769Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A1w-11 (SPAdes)EnvironmentalOpen in IMG/M
3300026779Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A2w-11 (SPAdes)EnvironmentalOpen in IMG/M
3300026822Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A1-12 (SPAdes)EnvironmentalOpen in IMG/M
3300026900Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G01K4-12 (SPAdes)EnvironmentalOpen in IMG/M
3300026939Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A5-12 (SPAdes)EnvironmentalOpen in IMG/M
3300026944Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G01K2-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027036Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G07A5-10 (SPAdes)EnvironmentalOpen in IMG/M
3300027407Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A5-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027425Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A2-10 (SPAdes)EnvironmentalOpen in IMG/M
3300027617Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027665Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300031197 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031248 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
F62_009481902170459010Grass SoilSALEAAMIVWKYIILFTCLGVGVALCVGAISILRSPPDNGPPAWFAAVLGAMFFWGAFALARWRHQ
INPgaii200_096405212228664022SoilMIVWKYVLLFTCLGIGAALCVGAISILRGPPDNGPPAWFAAVLGAMFFWGAFA
F14TC_10078147833300000559SoilMIVWKYVLLFTCLGIGAALCVGAISILRGPPDNGPPAWFAAVLGAMFFWGAFALARWRHH
JGI11643J11755_1180786823300000787SoilMIVWKYILLFTCLGIGVALCVGAISILRSPPDHGPPAWFAAVLGAMFF
JGI10214J12806_1115580413300000891SoilAMANWSVLEAAMIIWKYILLFTCLGIGVALCVGAISILRSPPDNGPPAWFAAVFGAMFFWGAFALARWRLQ*
JGI24740J21852_1003738833300001979Corn RhizosphereMIVLKYILLFTCLGIGLALCVGVISILRSPPDNGPPAWFAAAFGAMFFWGA
JGI24036J26619_1001508713300002128Corn, Switchgrass And Miscanthus RhizosphereMIALKYILLFTCLGIGLALCVGAISILRSPPDNGPPAWFAAAFGAMFFWGAFALA
Ga0062593_100003249123300004114SoilMIIWKYILLFTCLGIGVALCVGAISILRSPPDNGPPAWFAAVFGAMFFWG
Ga0062589_10000351813300004156SoilMIIWKYILLFTCLGIGVALCVGAISILRSPPDNGPPAWFAAVFGAMFFWGA
Ga0062595_10110728523300004479SoilAAMIVLKYILLFTCLVIGVALCVGAISIFRSPPDNGPPAWFAAVFSALFFWGAFALARWRHQ*
Ga0062595_10235150313300004479SoilVNSALEAAMIVWKYILLFTCLGVGVALCVGAISILRGPLDHGPPAWFAAVLGAMFFWGAFALTRWRHQ*
Ga0062594_10000055173300005093SoilMIVLKYILLFTCLGIGVALCVGAVSILRSPPDHGPPAWFAAVFGAMFFWGTFALARWRLQ
Ga0066821_101466023300005147SoilMIVWKYILLFTCLGIGVALCVGAISILRSPPDHGPPAWFAAAFGAMFLWG
Ga0066810_1003279423300005169SoilMIVWKYILLFTCLGIGVALCVGAISILRSPLDNGPPAWFAAAFGAMFFWGAFALARWR
Ga0065704_1040876813300005289Switchgrass RhizosphereMIVWKYVLLFTCLGIGAALCVGAISILRGPPDNGPPAWFAAVLGAMFFWGAFALARWKHQ
Ga0070676_1066096213300005328Miscanthus RhizosphereMIALKYILLFTCLGIGLALCVGAISILRSPPDNGPPAWFAAAFGAMFFWGAFALARWR
Ga0070690_10080609113300005330Switchgrass RhizosphereMIALKYILLFTCLGIGLALCVGAISILRSPPDNGPPAWFAAAFGAMFFWGAFALARWRLQ
Ga0070666_1134813123300005335Switchgrass RhizosphereMILWKYILLFTCLGIGVALCVGAISILGSPPGNGPPAWFAAVFGAMFFWGAFALARWR
Ga0070687_10046851513300005343Switchgrass RhizosphereMIALKYILLFTCLGIGLALCVGAISILRSPPDNGPPAWFAAAFGAMFFW
Ga0070669_10070313633300005353Switchgrass RhizosphereGSMIVGKYILLCTCLGIGVALCAGAISILSSPTDNGPPAWFAVVFGALFFWGAFALSRWKHQ*
Ga0070675_10021106643300005354Miscanthus RhizosphereLCAGAISILSSPTDNGPPAWFAVVFGALFFWGAFALSRWKHQ*
Ga0070659_10078903613300005366Corn RhizosphereGRVNSALEAAMIVWKYILLFTCLGIGVALCVGAISILRSPPDHGPPAWFAAAFGAMFLWGAFALARWRHQ*
Ga0070678_10044703633300005456Miscanthus RhizosphereVNSALEAVMIALKYILLFTCLGIGLALCVGAISILRSATDSGPPPWFAAAFGAMFFWGAFALARWRLQ*
Ga0070707_10155768113300005468Corn, Switchgrass And Miscanthus RhizosphereMIVLKYILLFTCLGIGLALCVGVISILRSPPDNGPPAWFAAAFGAMFFWGAFALARWR
Ga0070699_10150686723300005518Corn, Switchgrass And Miscanthus RhizosphereMIVLKYILLFTCLGIGLALCVGVISILRSPPDNGPPAWFAAAFGAMFFWGAFAL
Ga0070697_10131993723300005536Corn, Switchgrass And Miscanthus RhizosphereVNSALEAAMIVLKYILLFTCLGIGLALCVGVISILRSPPDNGPPAWFAAAFGAMFFWGAF
Ga0070697_10154814323300005536Corn, Switchgrass And Miscanthus RhizosphereMIVGKYILLFTCLGIGVALCVGAISILRSPLDNGPPAWFAAAFGAMFFWGAFELARWRLQ
Ga0070672_10051743133300005543Miscanthus RhizosphereMIALKYILLFTCLGIGLALCVGAISILRSATDSGPPPWFAAAFGAMFFWGAFALARWRLQ
Ga0070686_10061202123300005544Switchgrass RhizosphereMIALKYILLFTCLGIGLALCVGAISILRSPPDNGPPAWFAAAFGAMFFWGAF
Ga0070696_10052449613300005546Corn, Switchgrass And Miscanthus RhizosphereVNSALEAAMIVWKYILLFTCLGIGVALCVGAISILRSPLDNGPPAWFAAAFGAMFFWGAFELARWRLQ*
Ga0070696_10052802713300005546Corn, Switchgrass And Miscanthus RhizosphereVWKYILLFTCLGIGVALCVGAISILKSPPDHGPPAWFAAVLGAMFFWGAFALARWRHQ*
Ga0068855_10139068413300005563Corn RhizosphereMIVWKYILLFTCLGIGVALCVGAISILRSPLDNGPPAWFAAAFGAMFFWGAF
Ga0068855_10165413713300005563Corn RhizosphereMIVGKYILLFTCLGIGVALCVGAISILRSPLDSGPPAWFAAVFGAMFFWGAFALSRWRHQ
Ga0070702_10056374423300005615Corn, Switchgrass And Miscanthus RhizosphereMILWRYILLFTCLGIGVALCVGAISILRSPPDHGPPAWFAAAFGAMFLWGAFALARWR
Ga0068858_10002513423300005842Switchgrass RhizosphereMILWKYILLFTCLGIGVALCVGAISILGSPPDNGPPAWFAAVFGAMFFWGAFALARWRLQ
Ga0075018_1054231323300006172WatershedsIGVALCVGAISILRSPPDNGPPAWFAAVLGAMFLWGAFALSRWRHE*
Ga0097621_10056082823300006237Miscanthus RhizosphereMIVWKYILLFTCLGIGVALCVGAISILRSPLDNGPPAWFAAAFGAMFFWG
Ga0075021_1000591313300006354WatershedsAVFFGGSMIVGKYILLFICLGIGVALCVGAISILRSPLDDGPPAWFAAMLGVVFFWGAFALSRWRHQ*
Ga0068865_10042953023300006881Miscanthus RhizosphereMTVGKYILLFTCLGIGVALCVGAISILRSPLDNGPPAWFAAAFGAMFFWGAFELARWRLQ
Ga0075426_1046893823300006903Populus RhizosphereMVWKYILLFTCLGIGVALCVGAISILRSPPESGPPAWFAAVLGAMFFWGAFALARWR
Ga0105242_1035711113300009176Miscanthus RhizosphereMILWKYILLFTCLGIGVALCVGAISILRSPLDNGPPAWFAAAFGAMFFWGAF
Ga0105237_1235659013300009545Corn RhizosphereMIVGKYILLFTCLGIGVALCVGAVSILRSPPDHGPPAWFAAVFGAMFLWVTFALAR
Ga0134128_1210969613300010373Terrestrial SoilIVLVYFGGSMIVGKYILLFTCLGIGVALFVGAISILSSPPDNGPPAWFAAVFGAMFFWGAFALSRWRHQ*
Ga0105239_1100525523300010375Corn RhizosphereILLFTCLGIGVALCVGAVSILRSPPDHGPPAWFAAVFGAMFFWGTFALARWRLQ*
Ga0134121_1221329323300010401Terrestrial SoilFIPKATDTALEVAMIVWKYILLFTCLGIGVALCVGAISILRSTLDSGPPAWFAAVFSAMFFWGAFALARWRPQ*
Ga0157353_100164523300012496Unplanted SoilMIVWKYILLFTCLGIGVALCVGAISILGSPPDNGPPAWFAAVFGAMFFWGAFELARWRLQ
Ga0157300_100448913300012884SoilMIVWKYILLFTCLGIGVALCVGAISILRSPPDHGPPAWFAAVLGAMFFWGAFALARWR
Ga0157305_1013888113300012891SoilLGIGVALCAGAISILSSPTDNGPPAWFAVVFGALFFWGAFALSRWKHQ*
Ga0157288_1000658013300012901SoilTCLGIGVALCAGPISILSSPTDNGPPAWFAVVFGALFFWGAFALSRWKHQ*
Ga0157282_1001977513300012904SoilGGSMIVGKYILLCTCLGIGVALCAGAISILSSPTDNGPPAWFAVVFGALFFWGAFALSRWKHQ*
Ga0157286_1034892313300012908SoilVNSALEAAMIVWKYILLFTCLGIGVALCVGAISILRSPPDHGPPAWFAAAFGAMFLWGAFAL
Ga0157298_1016208723300012913SoilMIVWKYILLFTCLGIGVALCVGAISILRSPPDNGPPAWFAAVLGAMFFWGAFAL
Ga0162652_10007719223300012941SoilLLARTQIVDRYLARIATVNWSALEAAMIVWKYILLFICLGIGVALCIGAISILRSPPDNGPPAWFAAVLVAMFFWGAFALARWRHQQHL*
Ga0164299_1027102833300012958SoilVGKYILLCTCLGIGVALCAGAISILSSPTDNGPPAWFAVVFGALFFWGAFALSRWKHQ*
Ga0164301_1013253143300012960SoilMIVGRYILLFACLGIGVALCVGAISIWRGPPDTGPPAWFAAGLGAMFFWGAFALSRWRHR
Ga0164302_1037033523300012961SoilMIVGKYILLFTCLGIGVALCVGAISIWRGPPDTGPPAWFAAGLGAMFFWGAFALTRWRHR
Ga0164309_1105116223300012984SoilMIVGKYILLFTCLGIGVALCVGAISILRSPPDHGPPAWFAAAFGAMFLWG
Ga0164304_1151085013300012986SoilMIVGKYILLFTCLGIGVALFVGAISILSSPPDNGPPAWFAAVFGAMFFWGAFALSRWMHQ
Ga0164307_1137394413300012987SoilMILWKYILLFTCLGIGMALCVGAISILGSPPDNGPPAWFAAVFGAMFFWGGFCA
Ga0157369_1031623223300013105Corn RhizosphereMIVWKYILLFTCLGIGVALCVGAISILRSPLDNGPPAWFAAAFGAMFFWGAFALARWRLQ
Ga0157378_1083824523300013297Miscanthus RhizosphereMIVGKYILLFTCLGIGVALCVGVISILSSPPDNGPPAWFAAVFGAMFFWGAFALSRWRHQ
Ga0163162_1092301213300013306Switchgrass RhizosphereMIVGKYILLFTCLGIGVALCVGAISILSSPPDNGPPAWFAAVFGAMFFWGAFALARWRHQ
Ga0157372_1096323413300013307Corn RhizosphereMIVGKYILLFTCLGIGVALCVGAISILGSPPGNGPPAWFAAVFGAMFFWGAF
Ga0157379_1109403823300014968Switchgrass RhizosphereIGVALCAGAISILSSPTDNGPPAWFAVVFGALFFWGAFALSRWKHQ*
Ga0132258_1028560133300015371Arabidopsis RhizosphereMIVLKYILLFTCLGIGVALCVGAVSILRSPLEHGPPAWFAAVFGAMFFWGTFALARWRLQ
Ga0132258_1058548073300015371Arabidopsis RhizosphereGQVNSALEAAMIVWKYILLFTCLGIGVALCVGAISILRSPPDSGPPAWFAAAFGAMFLWGAFALARWRLQ*
Ga0132257_10314082713300015373Arabidopsis RhizosphereMILWKYILLFTCLGIGVALCVGAISILGSPPGNGPPGWFAAVFGAMFFWGAFALARWRLQ
Ga0132257_10331541413300015373Arabidopsis RhizosphereVEAERKISTATVNWSALEAAMIVWKYILLFTCLGIGVALCVGAISILRSPPDNGPPAWFAAVLGAMFFWGAFALARWRRQ*
Ga0132255_10030048823300015374Arabidopsis RhizosphereMIVSKYILLFICLGIGVALCVGAISILRSPLDNGPPAWFAAAFGAIFLWGAFALARWRLQ
Ga0184611_107849223300018067Groundwater SedimentLFTCLGVGVALCVGAISILRSPPDNGPPAWFAAVLGAMFFWGAFALAR
Ga0184624_1045529823300018073Groundwater SedimentARIATVNWSALEAAMIVWKYIILFTCLGVGVALCVGAISILRSPPDNGPPAWFAAVLGGMFFWGAFALARWRHQ
Ga0173481_1000488353300019356SoilMIVLKYILLFTCLGIGLALCVGVISILRSPPDNGPPAWFAAAFGAMFFWGAFALARWRLQ
Ga0173481_1012481423300019356SoilMIVWKYILLFTCLGIGVALCVGAISILRSPLDNGPPAWFAAAFGAMFFWGAFELARWRLQ
Ga0193730_109310113300020002SoilLARIATVNWSALEAAMIVWKYIILFTCLGVGVALCVGAISILRSPPDNGPPAWFAAVLGAMFFWGAFALARWRHQ
Ga0247753_101299113300022892SoilSALEAAMIVWKYILLFTCLGIGVALCVGAISILRSPLDNGPPAWFAAAFGAMFFWGAFELARWRLQ
Ga0207696_118485623300025711Switchgrass RhizosphereMIVLKYILLFTCLGIGLALCVGVISILRSPPDNGPPAWFAAAFGAMFFW
Ga0207645_1002766813300025907Miscanthus RhizosphereMIVLKYILLFTCLGIGLALCVGVISILRSPPDNGPPAWFAAAFGAMFFWGAFALAR
Ga0207645_1012250013300025907Miscanthus RhizosphereMIALKYILLFTCLGIGLALCVGAISILRSPPDNGPPAWFAAAFGAMFFWGAFALAR
Ga0207654_1041434723300025911Corn RhizosphereMIVGKYILLFTCLGIGVALCVGAISILSSPPDNGPPAWFAAVFGAMFFWGAFALSRWR
Ga0207660_1029691313300025917Corn RhizosphereMIVGKYILLCTCLGIGVALFVGAISILSSPPDNGPPAWFAAVFGALFFW
Ga0207659_1047992413300025926Miscanthus RhizosphereLLCTCLGIGVALCAGAISILSSPTDNGPPAWFAVVFGALFFWGAFALSRWKHQ
Ga0207701_1004260923300025930Corn, Switchgrass And Miscanthus RhizosphereMIVGKYILLFTCLGIGVALCAGAISIWRSPPDHGPPAWFAAVFGAMFLWGAFALTRWRHQ
Ga0207670_1180530313300025936Switchgrass RhizosphereMTVGKYILLFTCLGIGVALCVGAISILRSPPDNGPPAWFAAALGAMFFWGAFGLSRWRHP
Ga0207669_1017455413300025937Miscanthus RhizosphereMIVLKYILLFTCLGIGVALCVGAVSILRSPPDHGPPAWFAAVFGAMFFWGAFALARWRLQ
Ga0207668_1011885543300025972Switchgrass RhizosphereMIVGKYILLCTCLGIGVALCAGAISILSSPTDNGPPAWFAVVFGALFFWGAFALSRWKHQ
Ga0207703_1214964623300026035Switchgrass RhizosphereMILWKYILLFTCLGIGVALCVGAISILGSPPGNGPPAWFAAVFGAMFFWGA
Ga0207678_1069254923300026067Corn RhizosphereMIVGKYILLFTCLGIGVALCVGAISIWRGPPDTGPPAWFAAGLGAMFFWGAFALLRWRHR
Ga0207708_1003839413300026075Corn, Switchgrass And Miscanthus RhizosphereMILWKYILLFTCLGIGVALCVGAISILGSPPGNGPPAWFAAVFGAMFFWGAFALARWRLQ
Ga0207648_1062227613300026089Miscanthus RhizosphereMIVLKYILLFTCLGIGVALCVGAVSILRSPPDHGPPAWFAAVFGAMFFW
Ga0207676_1112661113300026095Switchgrass RhizosphereMILWKYILLFTCLGIGVALCVGAISILGSPPGNGPPAWFAAVFGAMFFWGAFAL
Ga0207675_10061615423300026118Switchgrass RhizosphereMTVGKYILLFTCLGIGVALCVGAISILRSPPDNGPPAWFAAALGAMFFWG
Ga0207698_1088284013300026142Corn RhizosphereMIVWKYILLFTCLGIGVALCVGAISILRSPPDHGPPAWFAAAFGAMFLWGAFALAR
Ga0207438_10025713300026719SoilIGLALCVGVISILRSPPDNGPPAWFAAAFGAMFFWGAFALARWRLQ
Ga0207440_10187423300026720SoilMIVLKYILLFTCLGIGLALCVGVISILRSPPDNGPPAWFAAAFGAMFFWGAFALARW
Ga0207492_10019613300026769SoilFTCLGIGLALCVGVISILRSPPDNGPPAWFAAAFGAMFFWGAFALARWRLQ
Ga0207471_10425223300026779SoilMIALKYILLFTCLGIGLALCVGVISILRSPPDNGPPAWFAAAFGAMFFWGAFALARWRL
Ga0207498_10012143300026822SoilMIVWKYILLFTCLGIGVALCVGAISILRSPPDNGPPAWFAAAFGAMFFWGAFALARWRLQ
Ga0207444_100104123300026900SoilMIVLKYILLFTCLGIGLALCVGAISILRSPPDNGPPAWFAAAFGAMFFWGAFALARWRLQ
Ga0207542_10263423300026939SoilMIVLKYILLFTCLGIGLALCVGVISILRSPPDNGPPAWFAAAFGAMFFWG
Ga0207570_100775913300026944SoilFRGQVNSALEAAMIVWKYILLFTCLGIGVALCVGAISILRSPPDHGPPAWFAAVLGAMFFWGAFALARWRHQ
Ga0207467_100433523300027036SoilMIVLKYILLFTCLGIGLALCVGAISILRSPLDNGPPAWFAAAFGAMFFWGAFALARWRLQ
Ga0207520_10100333300027407SoilLFTCLGIGLALCVGAISILRSPPDNGPPAWFAAAFGAMFFWGAFALARWRLQ
Ga0207522_10051823300027425SoilMIVLKYILLFTCLGIGLALCVGVISILRSPPDNGPPAWFAAAFGAMFFWGAFALA
Ga0210002_106475013300027617Arabidopsis Thaliana RhizosphereMIVWKYILLFTCLGIGVALCVGAITILRSPPDHGPPAWFAAALGAMFFWGAFALARWRHQ
Ga0209983_100374943300027665Arabidopsis Thaliana RhizosphereMIVWKYILLFTCLGIGVALCVGAISILRSPPDHGPPAWFAAVLGAMFFWGAFALARWRLQ
Ga0209068_1003281723300027894WatershedsMIVWKYILLFTCLGIGVALCVGAISILRSPPDNGPPAWFAAVLGAMFLWGAFALSRWRHE
Ga0209583_1056568413300027910WatershedsMIVGKYILLFICLGIGVALCVGAISILRSPLDDGPPAWFAAMLGVVFFWGAFALSRWRHQ
Ga0307317_1020055523300028720SoilMIVWKYIILFTCLGVGVALCVGAISILRSPPDNGPPAWFAAVLGGMFFWG
Ga0307316_1007750813300028755SoilQDLARIATVNWSALEAAMIVWKYIILFTCLGVGVALCVGAISILRSPPDNGPPAWFAAVLGAMFFWGAFALARWRHQ
Ga0307305_1057266623300028807SoilMKVWKYTFLFICLGIGVALCVGAISILRHHPDEGPPAWFAAALGAIFFWGAFALSRWKAD
Ga0307292_1024755613300028811SoilMIVWKYIILFTCLGVGVALCVGAISILRSPPDNGPPAWFAAVLGAMFFWGAFALAR
Ga0307302_1036014313300028814SoilMEAAVKVWKYTFLFICLGIGVALCVGAISILRHHPDDGPPAAFAAALGAIFFWGAFALSRWKAD
(restricted) Ga0255310_1000467853300031197Sandy SoilMIVWKYILLFTCLGIGVALCVGAISIFRSPPDHGPPAWFAAVLGAMFFWGAFALARWRPQ
Ga0307497_1010868923300031226SoilMIVGKYILLFTCLGIGVALCVGAISILRSPPDNGPPAWFAAVLGAMFFWGAFALSRWRHRPAFAR
Ga0307497_1019637823300031226SoilMIVGKYILLFTCLGIGVALCVGAISILRSPPDNGPPAWFAAVLGAMFFWGAFALS
(restricted) Ga0255312_100445913300031248Sandy SoilVWKYILLFTCLGIGVALCVGAISILRSPPEHGPPAWFAAALGAMFFWGAFALARWRHQ
(restricted) Ga0255312_112736013300031248Sandy SoilVNSALEVAMIVWKYILLFTCLGIGVALCVGTISILRSPPDHGPPAWFAAVLGAMFFWGAFAL
Ga0310904_1001876323300031854SoilMIALKYILLFTCLGIGLALCVGVISILRSPPDNGPPAWFAAAFGAMFFWGAFALARWRLQ
Ga0310901_1000085323300031940SoilMIVGKYILLFTCLGIGVALCVGAISILRSPPDNGPPAWFAAALGAMFFWGAFGLSRWRHP
Ga0310884_1086342923300031944SoilMIALKYILLFTCLGIGLALCVGAISILRSPPDNGPPAWFAAAFGAMFFWGAFA
Ga0307472_10111072713300032205Hardwood Forest SoilRQVNSALEAAMIVWKYILLFTCLGIGVALCVGAISILRSPPDHGPPAWFAAVFGVMFLWGAFALARWRLQ
Ga0335082_1049112913300032782SoilMRVWKYILLFTCLGIGVALCVGALSILRSPPDNGPPAWFAAVLGAMFFWA
Ga0335081_1070021633300032892SoilPARISTVEAAMRVWKYILLFTCLGIGVALCVGAISILRSPSDNGPPAWFAAVLGAMFFWGAFALARWRHH
Ga0326726_1009756953300033433Peat SoilMIVWKYIFLFTCLGIGVALCVGAISILRSPPDNGPPAWFAAVLGAIFFWGAFALARWRHQ
Ga0326723_0591436_3_1973300034090Peat SoilLEAAMIVWKYILLFTCLGIGVALCVGAISILRSPPDNGPPALFAAVLGAMFFWGAFALARWRHQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.