NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F041786

Metagenome / Metatranscriptome Family F041786

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F041786
Family Type Metagenome / Metatranscriptome
Number of Sequences 159
Average Sequence Length 44 residues
Representative Sequence AFRHSLMTFGNKFSASEVDDAFAEFKIDGGMIDAAHLKGLMVSK
Number of Associated Samples 127
Number of Associated Scaffolds 159

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 2.52 %
% of genes near scaffold ends (potentially truncated) 96.23 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 113
AlphaFold2 3D model prediction Yes
3D model pTM-score0.31

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (63.522 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(73.585 % of family members)
Environment Ontology (ENVO) Unclassified
(86.164 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(89.308 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 29.17%    β-sheet: 5.56%    Coil/Unstructured: 65.28%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.31
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 159 Family Scaffolds
PF13405EF-hand_6 1.26


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms63.52 %
UnclassifiedrootN/A36.48 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004810|Ga0007757_11176780Not Available584Open in IMG/M
3300006399|Ga0075495_1201894All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex575Open in IMG/M
3300006850|Ga0075491_1008517Not Available630Open in IMG/M
3300007217|Ga0079268_1324325All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus801Open in IMG/M
3300007304|Ga0102689_1000629Not Available656Open in IMG/M
3300008799|Ga0103766_1020263All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Tenebrionoidea → Tenebrionidae → Tenebrionidae incertae sedis → Tribolium → Tribolium castaneum567Open in IMG/M
3300008832|Ga0103951_10205854Not Available961Open in IMG/M
3300008832|Ga0103951_10379634All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus748Open in IMG/M
3300008832|Ga0103951_10409174All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus723Open in IMG/M
3300008833|Ga0103881_100352Not Available652Open in IMG/M
3300008834|Ga0103882_10016749Not Available857Open in IMG/M
3300008834|Ga0103882_10061117Not Available592Open in IMG/M
3300008998|Ga0103502_10240173All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus665Open in IMG/M
3300009022|Ga0103706_10055181All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus833Open in IMG/M
3300009022|Ga0103706_10055617Not Available830Open in IMG/M
3300009022|Ga0103706_10167397All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus555Open in IMG/M
3300009028|Ga0103708_100063236Not Available846Open in IMG/M
3300009028|Ga0103708_100188582Not Available591Open in IMG/M
3300009274|Ga0103878_1011485Not Available826Open in IMG/M
3300009276|Ga0103879_10001801Not Available999Open in IMG/M
3300009279|Ga0103880_10004964All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1064Open in IMG/M
3300009333|Ga0103833_1002642All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus640Open in IMG/M
3300009341|Ga0103836_1002276All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus822Open in IMG/M
3300009353|Ga0103847_1002701All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus799Open in IMG/M
3300009436|Ga0115008_10605186All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus789Open in IMG/M
3300010981|Ga0138316_10917052Not Available593Open in IMG/M
3300010981|Ga0138316_11334997Not Available614Open in IMG/M
3300010985|Ga0138326_10228971All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus564Open in IMG/M
3300011381|Ga0102688_1622226All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus547Open in IMG/M
3300012525|Ga0129353_1094463Not Available509Open in IMG/M
3300013074|Ga0157618_1011237Not Available646Open in IMG/M
3300018498|Ga0193224_10370All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus702Open in IMG/M
3300018499|Ga0193235_101097Not Available771Open in IMG/M
3300018504|Ga0193465_102674All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus786Open in IMG/M
3300018504|Ga0193465_105381All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus562Open in IMG/M
3300018509|Ga0192995_100520All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus768Open in IMG/M
3300018521|Ga0193171_105574All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus571Open in IMG/M
3300018524|Ga0193057_102533All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus985Open in IMG/M
3300018524|Ga0193057_104240All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus800Open in IMG/M
3300018524|Ga0193057_104592All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus769Open in IMG/M
3300018534|Ga0193486_109933All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus532Open in IMG/M
3300018535|Ga0193164_1002700All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex805Open in IMG/M
3300018546|Ga0193014_106936Not Available541Open in IMG/M
3300018581|Ga0193079_1002788All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus886Open in IMG/M
3300018581|Ga0193079_1003970All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus797Open in IMG/M
3300018581|Ga0193079_1010701All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus579Open in IMG/M
3300018582|Ga0193454_1011164All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus670Open in IMG/M
3300018585|Ga0193221_1004184All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus838Open in IMG/M
3300018586|Ga0193498_1010060All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus808Open in IMG/M
3300018588|Ga0193141_1007433All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus788Open in IMG/M
3300018589|Ga0193320_1023169All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus516Open in IMG/M
3300018594|Ga0193292_1004519All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus838Open in IMG/M
3300018594|Ga0193292_1012023All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus617Open in IMG/M
3300018598|Ga0192817_1004345All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus797Open in IMG/M
3300018598|Ga0192817_1005955All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Tenebrionoidea → Tenebrionidae → Tenebrionidae incertae sedis → Tribolium → Tribolium castaneum717Open in IMG/M
3300018598|Ga0192817_1005962All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus717Open in IMG/M
3300018602|Ga0193182_1005833Not Available980Open in IMG/M
3300018604|Ga0193447_1015361Not Available688Open in IMG/M
3300018609|Ga0192959_1040954All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus580Open in IMG/M
3300018634|Ga0193134_1011201All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus745Open in IMG/M
3300018646|Ga0192895_1008954All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus895Open in IMG/M
3300018646|Ga0192895_1024407All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus568Open in IMG/M
3300018648|Ga0193445_1039732Not Available605Open in IMG/M
3300018648|Ga0193445_1046202Not Available554Open in IMG/M
3300018659|Ga0193067_1030114All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus811Open in IMG/M
3300018669|Ga0193108_108366Not Available796Open in IMG/M
3300018676|Ga0193137_1040444Not Available664Open in IMG/M
3300018678|Ga0193007_1019726All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus938Open in IMG/M
3300018686|Ga0192840_1015153All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Tenebrionoidea → Tenebrionidae → Tenebrionidae incertae sedis → Tribolium → Tribolium castaneum887Open in IMG/M
3300018691|Ga0193294_1017528All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus822Open in IMG/M
3300018694|Ga0192853_1034367All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus875Open in IMG/M
3300018697|Ga0193319_1036590Not Available774Open in IMG/M
3300018703|Ga0193274_1023644Not Available630Open in IMG/M
3300018707|Ga0192876_1053713Not Available638Open in IMG/M
3300018721|Ga0192904_1022592All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1001Open in IMG/M
3300018721|Ga0192904_1024824All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus953Open in IMG/M
3300018737|Ga0193418_1070385All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus563Open in IMG/M
3300018748|Ga0193416_1037656All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus804Open in IMG/M
3300018753|Ga0193344_1027373All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus829Open in IMG/M
3300018763|Ga0192827_1033119Not Available890Open in IMG/M
3300018773|Ga0193396_1048463All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus664Open in IMG/M
3300018777|Ga0192839_1037942All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus747Open in IMG/M
3300018782|Ga0192832_1013668Not Available969Open in IMG/M
3300018783|Ga0193197_1064436All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus543Open in IMG/M
3300018792|Ga0192956_1046535All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1212Open in IMG/M
3300018794|Ga0193357_1035561Not Available813Open in IMG/M
3300018808|Ga0192854_1079941Not Available610Open in IMG/M
3300018809|Ga0192861_1032781Not Available984Open in IMG/M
3300018821|Ga0193412_1082624Not Available500Open in IMG/M
3300018827|Ga0193366_1074084All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus503Open in IMG/M
3300018829|Ga0193238_1065141All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus774Open in IMG/M
3300018857|Ga0193363_1092782All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus612Open in IMG/M
3300018889|Ga0192901_1068711All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus783Open in IMG/M
3300018909|Ga0193160_10033059Not Available729Open in IMG/M
3300018911|Ga0192987_1140020All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus627Open in IMG/M
3300018919|Ga0193109_10119424Not Available798Open in IMG/M
3300018924|Ga0193096_10185257All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus687Open in IMG/M
3300018925|Ga0193318_10100916Not Available853Open in IMG/M
3300018929|Ga0192921_10169587Not Available669Open in IMG/M
3300018940|Ga0192818_10047758Not Available882Open in IMG/M
3300018940|Ga0192818_10099796Not Available714Open in IMG/M
3300018947|Ga0193066_10103141All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus830Open in IMG/M
3300018947|Ga0193066_10103959All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus827Open in IMG/M
3300018947|Ga0193066_10162366All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus648Open in IMG/M
3300018947|Ga0193066_10165054All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus642Open in IMG/M
3300018949|Ga0193010_10038561Not Available741Open in IMG/M
3300018951|Ga0193128_10013603All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1624Open in IMG/M
3300018955|Ga0193379_10213130All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus527Open in IMG/M
3300018958|Ga0193560_10183694All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Tenebrionoidea → Tenebrionidae → Tenebrionidae incertae sedis → Tribolium → Tribolium castaneum656Open in IMG/M
3300018966|Ga0193293_10093005All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus578Open in IMG/M
3300018969|Ga0193143_10060009All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1056Open in IMG/M
3300018970|Ga0193417_10193702All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus638Open in IMG/M
3300018973|Ga0193330_10169962All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus660Open in IMG/M
3300018974|Ga0192873_10349172All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus613Open in IMG/M
3300018977|Ga0193353_10094777All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus900Open in IMG/M
3300018977|Ga0193353_10119063All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus796Open in IMG/M
3300018978|Ga0193487_10201724All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus656Open in IMG/M
3300018978|Ga0193487_10253459Not Available554Open in IMG/M
3300018979|Ga0193540_10081839All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus876Open in IMG/M
3300018982|Ga0192947_10144026Not Available795Open in IMG/M
3300018982|Ga0192947_10279337Not Available528Open in IMG/M
3300018983|Ga0193017_10140614All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus803Open in IMG/M
3300018985|Ga0193136_10078927All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus920Open in IMG/M
3300018988|Ga0193275_10118457Not Available780Open in IMG/M
3300018988|Ga0193275_10123153Not Available768Open in IMG/M
3300018996|Ga0192916_10120054Not Available788Open in IMG/M
3300018998|Ga0193444_10141396Not Available638Open in IMG/M
3300018999|Ga0193514_10133283All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus910Open in IMG/M
3300018999|Ga0193514_10161787All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus816Open in IMG/M
3300018999|Ga0193514_10190590All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Tenebrionoidea → Tenebrionidae → Tenebrionidae incertae sedis → Tribolium → Tribolium castaneum741Open in IMG/M
3300019001|Ga0193034_10073365Not Available746Open in IMG/M
3300019004|Ga0193078_10055432All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus810Open in IMG/M
3300019010|Ga0193044_10153547All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus750Open in IMG/M
3300019013|Ga0193557_10264942All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus534Open in IMG/M
3300019022|Ga0192951_10193428All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus742Open in IMG/M
3300019043|Ga0192998_10147362Not Available665Open in IMG/M
3300019067|Ga0193459_100735Not Available961Open in IMG/M
3300019092|Ga0192836_1028069Not Available539Open in IMG/M
3300019092|Ga0192836_1029824All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus519Open in IMG/M
3300019105|Ga0193374_1008926Not Available730Open in IMG/M
3300019115|Ga0193443_1032552All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus529Open in IMG/M
3300019126|Ga0193144_1051062All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Tenebrionoidea → Tenebrionidae → Tenebrionidae incertae sedis → Tribolium → Tribolium castaneum699Open in IMG/M
3300019147|Ga0193453_1085139All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus839Open in IMG/M
3300019148|Ga0193239_10162978Not Available849Open in IMG/M
3300021859|Ga0210334_10498086All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus775Open in IMG/M
3300021866|Ga0063109_104756Not Available667Open in IMG/M
3300021871|Ga0063129_103456Not Available931Open in IMG/M
3300030951|Ga0073937_10025250Not Available618Open in IMG/M
3300030955|Ga0073943_10005745All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus674Open in IMG/M
3300031674|Ga0307393_1054715All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus827Open in IMG/M
3300031674|Ga0307393_1148026All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus529Open in IMG/M
3300031739|Ga0307383_10483001Not Available616Open in IMG/M
3300031743|Ga0307382_10133818Not Available1071Open in IMG/M
3300032491|Ga0314675_10351972All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus736Open in IMG/M
3300032491|Ga0314675_10609285All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus534Open in IMG/M
3300032491|Ga0314675_10647867All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus515Open in IMG/M
3300032517|Ga0314688_10515615All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus649Open in IMG/M
3300032520|Ga0314667_10761591All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus526Open in IMG/M
3300032650|Ga0314673_10448935All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus664Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine73.58%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine8.18%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.77%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water3.77%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water3.14%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.89%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water1.89%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous1.89%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.63%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.63%
Eutrophic PondEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Eutrophic Pond0.63%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004810Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006399Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006850Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007217Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S10 NT17 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007304Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300008799Planktonic communities from eutrophic pond at the campus Essen of the University Duisburg-Essen, Germany - sample NO3-1EnvironmentalOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008833Eukaryotic communities of water from the North Atlantic ocean - ACM7EnvironmentalOpen in IMG/M
3300008834Eukaryotic communities of water from the North Atlantic ocean - ACM26EnvironmentalOpen in IMG/M
3300008998Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_A100000548EnvironmentalOpen in IMG/M
3300009022Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S1EnvironmentalOpen in IMG/M
3300009028Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S3EnvironmentalOpen in IMG/M
3300009274Eukaryotic communities of water from the North Atlantic ocean - ACM10EnvironmentalOpen in IMG/M
3300009276Eukaryotic communities of water from the North Atlantic ocean - ACM57EnvironmentalOpen in IMG/M
3300009279Eukaryotic communities of water from the North Atlantic ocean - ACM42EnvironmentalOpen in IMG/M
3300009333Microbial communities of water from the North Atlantic ocean - ACM52EnvironmentalOpen in IMG/M
3300009341Microbial communities of water from the North Atlantic ocean - ACM17EnvironmentalOpen in IMG/M
3300009353Microbial communities of water from the North Atlantic ocean - ACM49EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300011381Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300012525Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013074Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES147 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018498Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_047 - TARA_G000000124 (ERX1782113-ERR1711919)EnvironmentalOpen in IMG/M
3300018499Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_051 - TARA_N000000196 (ERX1782145-ERR1712092)EnvironmentalOpen in IMG/M
3300018504Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002418 (ERX1782261-ERR1712132)EnvironmentalOpen in IMG/M
3300018509Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001642 (ERX1782430-ERR1711958)EnvironmentalOpen in IMG/M
3300018521Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000311 (ERX1782300-ERR1712011)EnvironmentalOpen in IMG/M
3300018524Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002422 (ERX1782099-ERR1711883)EnvironmentalOpen in IMG/M
3300018534Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_136 - TARA_N000002965 (ERX1789412-ERR1719179)EnvironmentalOpen in IMG/M
3300018535Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_E500000200 (ERX1782124-ERR1711984)EnvironmentalOpen in IMG/M
3300018546Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_136 - TARA_N000002959 (ERX1789637-ERR1719441)EnvironmentalOpen in IMG/M
3300018581Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_051 - TARA_N000000225 (ERX1782098-ERR1712053)EnvironmentalOpen in IMG/M
3300018582Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002402 (ERX1789727-ERR1719292)EnvironmentalOpen in IMG/M
3300018585Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000269 (ERX1782265-ERR1712044)EnvironmentalOpen in IMG/M
3300018586Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002942 (ERX1782243-ERR1712114)EnvironmentalOpen in IMG/M
3300018588Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000538 (ERX1782191-ERR1712140)EnvironmentalOpen in IMG/M
3300018589Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001664 (ERX1782130-ERR1711875)EnvironmentalOpen in IMG/M
3300018594Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001614 (ERX1809463-ERR1739849)EnvironmentalOpen in IMG/M
3300018598Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000536 (ERX1782248-ERR1712090)EnvironmentalOpen in IMG/M
3300018602Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000319 (ERX1782193-ERR1711945)EnvironmentalOpen in IMG/M
3300018604Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002362 (ERX1782200-ERR1712077)EnvironmentalOpen in IMG/M
3300018609Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001400 (ERX1782449-ERR1712128)EnvironmentalOpen in IMG/M
3300018634Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_020 - TARA_A100000759 (ERX1782198-ERR1712237)EnvironmentalOpen in IMG/M
3300018646Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000713 (ERX1782189-ERR1712202)EnvironmentalOpen in IMG/M
3300018648Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002360 (ERX1782304-ERR1712027)EnvironmentalOpen in IMG/M
3300018659Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003102 (ERX1782249-ERR1712111)EnvironmentalOpen in IMG/M
3300018669Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_139 - TARA_N000003043 (ERX1789562-ERR1719304)EnvironmentalOpen in IMG/M
3300018676Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_020 - TARA_A100000761 (ERX1782202-ERR1711913)EnvironmentalOpen in IMG/M
3300018678Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002350 (ERX1782149-ERR1712036)EnvironmentalOpen in IMG/M
3300018686Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000593 (ERX1789430-ERR1719415)EnvironmentalOpen in IMG/M
3300018691Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001616 (ERX1782222-ERR1712214)EnvironmentalOpen in IMG/M
3300018694Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000539 (ERX1782273-ERR1712042)EnvironmentalOpen in IMG/M
3300018697Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001662 (ERX1789701-ERR1719308)EnvironmentalOpen in IMG/M
3300018703Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001580 (ERX1782405-ERR1712108)EnvironmentalOpen in IMG/M
3300018707Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000746 (ERX1789613-ERR1719509)EnvironmentalOpen in IMG/M
3300018721Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000666 (ERX1789483-ERR1719260)EnvironmentalOpen in IMG/M
3300018737Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002025 (ERX1789417-ERR1719385)EnvironmentalOpen in IMG/M
3300018748Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002025 (ERX1789516-ERR1719249)EnvironmentalOpen in IMG/M
3300018753Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001764 (ERX1789594-ERR1719358)EnvironmentalOpen in IMG/M
3300018763Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782288-ERR1711868)EnvironmentalOpen in IMG/M
3300018773Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002037 (ERX1789391-ERR1719301)EnvironmentalOpen in IMG/M
3300018777Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000589 (ERX1789605-ERR1719349)EnvironmentalOpen in IMG/M
3300018782Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000570 (ERX1782313-ERR1712019)EnvironmentalOpen in IMG/M
3300018783Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000011 (ERX1782442-ERR1712209)EnvironmentalOpen in IMG/M
3300018792Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001398 (ERX1782120-ERR1711892)EnvironmentalOpen in IMG/M
3300018794Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001823 (ERX1782102-ERR1711992)EnvironmentalOpen in IMG/M
3300018808Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000925 (ERX1782319-ERR1711931)EnvironmentalOpen in IMG/M
3300018809Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000981 (ERX1789406-ERR1719516)EnvironmentalOpen in IMG/M
3300018821Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002021 (ERX1789489-ERR1719145)EnvironmentalOpen in IMG/M
3300018827Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001938 (ERX1782415-ERR1712182)EnvironmentalOpen in IMG/M
3300018829Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001477 (ERX1789429-ERR1719435)EnvironmentalOpen in IMG/M
3300018857Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001828 (ERX1789640-ERR1719290)EnvironmentalOpen in IMG/M
3300018889Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000728 (ERX1789501-ERR1719269)EnvironmentalOpen in IMG/M
3300018909Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000402 (ERX1782377-ERR1712208)EnvironmentalOpen in IMG/M
3300018911Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001042 (ERX1809744-ERR1740134)EnvironmentalOpen in IMG/M
3300018919Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_139 - TARA_N000003043 (ERX1789401-ERR1719342)EnvironmentalOpen in IMG/M
3300018924Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000046 (ERX1789468-ERR1719259)EnvironmentalOpen in IMG/M
3300018925Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001662 (ERX1789484-ERR1719312)EnvironmentalOpen in IMG/M
3300018929Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000843 (ERX1782134-ERR1712223)EnvironmentalOpen in IMG/M
3300018940Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000536 (ERX1782257-ERR1712105)EnvironmentalOpen in IMG/M
3300018947Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003102 (ERX1782406-ERR1712029)EnvironmentalOpen in IMG/M
3300018949Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002172 (ERX1782262-ERR1712034)EnvironmentalOpen in IMG/M
3300018951Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001338 (ERX1782096-ERR1711860)EnvironmentalOpen in IMG/M
3300018955Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001972 (ERX1789369-ERR1719393)EnvironmentalOpen in IMG/M
3300018958Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_144 - TARA_N000003191EnvironmentalOpen in IMG/M
3300018966Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001614 (ERX1809469-ERR1739845)EnvironmentalOpen in IMG/M
3300018969Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000539 (ERX1782234-ERR1712179)EnvironmentalOpen in IMG/M
3300018970Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002025 (ERX1789437-ERR1719295)EnvironmentalOpen in IMG/M
3300018973Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001742 (ERX1789408-ERR1719300)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018977Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001816 (ERX1782322-ERR1711977)EnvironmentalOpen in IMG/M
3300018978Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_136 - TARA_N000002965 (ERX1789639-ERR1719422)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018983Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000002997 (ERX1782408-ERR1712000)EnvironmentalOpen in IMG/M
3300018985Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_020 - TARA_A100000761 (ERX1782416-ERR1711874)EnvironmentalOpen in IMG/M
3300018988Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001580 (ERX1782315-ERR1711974)EnvironmentalOpen in IMG/M
3300018996Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000839 (ERX1782178-ERR1712156)EnvironmentalOpen in IMG/M
3300018998Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002360 (ERX1782428-ERR1712117)EnvironmentalOpen in IMG/M
3300018999Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003100 (ERX1782275-ERR1712038)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019004Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_051 - TARA_N000000225 (ERX1782445-ERR1712173)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019013Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003089EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019043Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001784 (ERX1782103-ERR1712098)EnvironmentalOpen in IMG/M
3300019067Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002412 (ERX1782229-ERR1712040)EnvironmentalOpen in IMG/M
3300019092Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000585 (ERX1782296-ERR1712033)EnvironmentalOpen in IMG/M
3300019105Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001942 (ERX1782301-ERR1712219)EnvironmentalOpen in IMG/M
3300019115Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002358 (ERX1782231-ERR1711979)EnvironmentalOpen in IMG/M
3300019126Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000695 (ERX1782402-ERR1712043)EnvironmentalOpen in IMG/M
3300019147Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002400 (ERX1782434-ERR1711973)EnvironmentalOpen in IMG/M
3300019148Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001477 (ERX1789676-ERR1719431)EnvironmentalOpen in IMG/M
3300021859Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.306 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021866Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021871Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S2 C18 B9 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030951Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_Q_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030955Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_T_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031674Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032491Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032520Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0007757_1117678023300004810Freshwater LakeMTFGDKFTAQEVDDAFAEFKIEDGMIDAVHLKSLMVAKKEGEES*
Ga0075495_120189413300006399AqueousQIDAEAFRHSLMTFGNKFSASEVDDAFAEFQIDGGMIDAAHLKNIMASS*
Ga0075491_100851723300006850AqueousDKFSSSEVDDAFAEFKVDGGMIDAAHLKGLMCSK*
Ga0079268_132432513300007217MarineAEAFRHSLMTFGNKFSAGEVDDAFAEMKIDEGMIDAAHLKGLMVAK*
Ga0102689_100062913300007304Freshwater LakeNKFTASEVDDAFAEFKIDGGMIDAAHLKSLMVSK*
Ga0103766_102026313300008799Eutrophic PondFRHSLMTFGDKFTAQECDDAFAEFKIEDGMIDAVHLKSLMVAKKEGEES*
Ga0103951_1020585413300008832MarineGVKFSASEVDDAFAEMKIDEGMIDAAHLKGLMVSK*
Ga0103951_1037963423300008832MarineFKHSLMTWGDKFSGQECDEAFAEFMISDGQIDAAHLKGLMVAKKEEAAE*
Ga0103951_1040917413300008832MarineETFRAQLMTFGNKFSASEVDDAFAEFKIDDGQIDAAHLKGLMVSK*
Ga0103881_10035213300008833Surface Ocean WaterAEAFRAQLMTFGNKFSASEVDDAFAEFQIDGGMIDAAHLKGLMVSK*
Ga0103882_1001674913300008834Surface Ocean WaterGNKFSASEVDDAFAEFKIDDGQIDAAHLKGLMVSK*
Ga0103882_1006111713300008834Surface Ocean WaterSLMAFGNKFSASEVDDAFAEFKIDGGMIDAAHLKGLMCSQ*
Ga0103502_1024017323300008998MarineDADAFRHSLMTFGVKFSASEVDDAFAEMKIDEGMIDAAHLKGLMVSK*
Ga0103706_1005518113300009022Ocean WaterIDAETFRAQLMTFGNKFSASEVDDAFAEFQIDGGMIDAAHLKGLMVSK*
Ga0103706_1005561713300009022Ocean WaterETFRAQLMTFGNKFSASEVDDAFAEFQIDGGMIDAAHLKGLMVSK*
Ga0103706_1016739713300009022Ocean WaterMTFGDKFSASEVDNAFGEFLIEDGMIDAVHLKGLMVSKKEEEAE*
Ga0103708_10006323623300009028Ocean WaterDAETFRAQLMTFGNKFSASEVDDAFAEFQIDGGMIDAAHLKGLMVSK*
Ga0103708_10018858213300009028Ocean WaterFGNKFSASEVDDAFAEFKIDDGQIDAAHLKGLMVSK*
Ga0103878_101148513300009274Surface Ocean WaterAQLMTFGNKVSASEVDDAFAEFQIDGGMIDAAHLKGLMVSK*
Ga0103879_1000180113300009276Surface Ocean WaterGKCAASEVDDAFAEMKIDEGMIDAAHLKGLMVSK*
Ga0103880_1000496413300009279Surface Ocean WaterMPFGNKFSASEVDDAFAEFKIDDGQIDAAHLKGLMVSK*
Ga0103833_100264223300009333River WaterSLMTFGDKFSASEVDNAFGEFLIEDGMIDAVHLKGLMVSKKEEEAE*
Ga0103836_100227613300009341River WaterQDGKIDAETFRAQLMTFGNKFSASEVDDAFAEFQIDGGMIDAAHLKGLMVSK*
Ga0103847_100270113300009353River WaterQLMTFGNKFSASEVDDAFAEFKIDDGQIDAAHLKGLMVSK*
Ga0115008_1060518613300009436MarineMTFGDKFTSAEVDNAFGEFSIEDGMIDAIQLKGEKYN*
Ga0138316_1091705213300010981MarineFGDKFTASEVDNAYSEFIIEDGMIDSMHLKGLMVSKKEEGEE*
Ga0138316_1133499713300010981MarineNKFSASEVDDAFAEFKIDDGQIDAAHLKGLMVSK*
Ga0138326_1022897113300010985MarineADAFRHSLMTFGVKFSASEVDDAFAEMKIDEGMIDAAHLKGLMVSK*
Ga0102688_162222623300011381Freshwater LakeFRHSLMTFGDKFTAQECDDAFAEFKIEDGMIDAVHLKSLMVAKKEGEE*
Ga0129353_109446313300012525AqueousFGNKFSASEVDDAFAEFQIDGGMIDAAHLKGLMVSK*
Ga0157618_101123723300013074FreshwaterGNKFTASEVDDAFAEFKIDGGMIDAAHLKSLMVSK*
Ga0193224_1037013300018498MarineAETFRAQLMTFGNKFSASEVDDAFAEFKIDDGQIDAAHLKGLMVSK
Ga0193235_10109723300018499MarineLMTFGNKFSASEVDDAFAEFQIDGGMIDAAHLKGLMVSK
Ga0193465_10267413300018504MarineIDAEAFRHSLMTFGNKFSASEVDDAFAEFKIDEGMIDGAHLKGLMVSK
Ga0193465_10538113300018504MarineFRHSLMTFGVKFSASEVDDAFAEMKIDEGMIDAAHLKGLMVAK
Ga0192995_10052013300018509MarineFRHSLMTFGVKFSASEVDDAFAEMKIDEGMIDAAHLKGLMVSK
Ga0193171_10557413300018521MarineDAETFRAQLMTFGNKFSASEVDDAFAEFKIDDGQIDAAHLKGLMVSK
Ga0193057_10253323300018524MarineDADAFRHSLMTFGVKFSASEVDDAFAEMKIDEGMIDAAHLKGLMVSK
Ga0193057_10424013300018524MarineETFRAQLMTFGNKFTASEVDDAFAEFQIDGGMIDAAHLKGLMVSK
Ga0193057_10459213300018524MarineAFRHSLMTFGVKFSASEVDDAFAEMKIDEGMIDAAHLKGLMVSK
Ga0193486_10993313300018534MarineAEMFKHSLMTFGDKFTSSEVDNAFSEFVIEDGMIDAVQLKGLMVSKKEEGEE
Ga0193164_100270013300018535MarineMGDGKIDAEAFRHSLMTFGNKFSASEVDEAFAEFKIDGDMIDAAHLKGLMVSK
Ga0193014_10693613300018546MarineTFRAQLMTFGNKFSASEVDDAFAEFQIDGGMIDAAHLKGLMVSK
Ga0193079_100278823300018581MarineMTFGNKFSAGEVDDAFAEFKIDGGMIDAAHLKGLMVSK
Ga0193079_100397013300018581MarineMTFGVKFSASEVDDAFAEFKIDDGQIDAAHLKGLMVSK
Ga0193079_101070113300018581MarineMTFGDKFSASEVDNAFGEFLIEDGMIDAVHLKGLMVSKKEEEAE
Ga0193454_101116413300018582MarineDAFRHSLMTFGVKFSASEVDDAFAEMKIDEGMIDAAHLKGLMVSK
Ga0193221_100418413300018585MarineKIDAETFRAQLMTFGNKFSASEVDDAFAEFQIDGGMIDAAHLKGLMVSK
Ga0193498_101006013300018586MarineDGKIDAETFRAQLMTFGNKFSASEVDDAFAEFQIDGGMIDAAHLKGLMVSK
Ga0193141_100743313300018588MarineDAETFRAQLMTFGNKFTVSEVDDAFAEFQIDGGMIDAAHLKGLMVSK
Ga0193320_102316913300018589MarineAFRHSLMTFGNKFSASEVDDAFAEFKIDGGMIDAAHLKGLMVSK
Ga0193292_100451913300018594MarineAEAFRHSLMTFGNKFSASEVDDAFAEFKIDEGMIDAAHLKGLMVAK
Ga0193292_101202313300018594MarineKIDAETFRAQLMTFGNKFSASEVDDAFAEFKIDDGQIDAAHLKGLMVSK
Ga0192817_100434513300018598MarineRHSLMTFGNKFSASEVDDAFAEFKIDEGMIDAAHLKGLMVSK
Ga0192817_100595513300018598MarineDGKIDAEMFRHSLMTFGDKFSAQEVEDAFAEFQIDGGMIDGEHLKGLMVAKK
Ga0192817_100596213300018598MarineRAQLMTFGNKFSASEVDDAFAEFKIDDGQIDAAHLKGLMVSK
Ga0193182_100583313300018602MarineHSLMTFGVKFSASEVDDAFAEMKIDEGMIDAAHLKGLMVSK
Ga0193447_101536113300018604MarineFGNKFSASEVDDAFAEFQIDGGMIDAAHLKGLMVSK
Ga0192959_104095423300018609MarineMDGKIEAEAFRHSHMTFGNKFSAGEDDDAFAEFKIDEGMIDAAHLKGLMVSK
Ga0193134_101120133300018634MarineESFRHSLMTFGVKFSASEVDDAFAEMKIDEGMIDAAHLKGLMVSK
Ga0192895_100895423300018646MarineFRHSLMTFGNKFSASEVDDAFAEFQIDEGMIDGAHLKGLMVSK
Ga0192895_102440713300018646MarineSLMTFGDKFSASEVDNAFGEFLIEDGMIDAVHLKGLMVSKKEEEAE
Ga0193445_103973213300018648MarineETFRAQLMTFGNKFSASEVDDAFAEFKIDGGMIDAAHLKGLMSS
Ga0193445_104620213300018648MarineETFRAQLMTFGNKFSASEVDDAFAEFKIDGGMIDAAHLKGLMCSQ
Ga0193067_103011413300018659MarineRHSLMTFGNKFSASEVDDAFAEFKIDEGMIDAAHLKGLMVAK
Ga0193108_10836623300018669MarineETFRAQLMTFGNKFSASEVDDAFAEFQIDGGMIDAAHLKGLMVSK
Ga0193137_104044413300018676MarineMTFGVKFSASEVDDAFAEMKIDEGMIDAAHLKGLMVAK
Ga0193007_101972613300018678MarineEMFRHSLMTFGDKFSAQEVEDAFAEFQITDGNIDAEHLKGLMVAKK
Ga0192840_101515313300018686MarineGQIDAEMFRHSLMTFGDKFSAQEVEDAFAEFTITDGMIDANHLKGLMVSKKK
Ga0193294_101752813300018691MarineMTFGNKFSASEVDDAFAEFKIDDGQIDAAHLKGLMVSK
Ga0192853_103436713300018694MarineIDAEAFRHSLMTFGNKFSASEVDDAFAEFQIDGGMIDAAHLKGLMVSK
Ga0193319_103659023300018697MarineEQDGKIDAETFRAQLMTFGNKFSASEVDDAFAEFKIDGGMIDAAHLKGLMCSQ
Ga0193274_102364423300018703MarineRHSLMTFGDKFSAQEVEDAFAEFRIDGGMIDGEHLKGLMVAKK
Ga0192876_105371313300018707MarineGNKFSASEVDDAFAEFQIDGGMIDAAHLKGLMVSK
Ga0192904_102259213300018721MarineAFRHSLMTFGNKFSAGEVDDAFAEMKIDEGMIDAAHLKGLMVAK
Ga0192904_102482413300018721MarineDADAFRHSLMTFGNKFSAGEVDDAFAEMKIDEGMIDAAHLKGLMVSK
Ga0193418_107038513300018737MarineIDAEAFRHSLMTFGNKFSAAEVDDAFAEFKIDGGMIDAAHLKGLMASN
Ga0193416_103765613300018748MarineFRHSLMTFGNKFSASEVDDAFAEFKIDEGMIDAAHLKGLMVAK
Ga0193344_102737323300018753MarineAFRHSLMTFGNKFSASEVDDAFAEFQIDGGMIDAAHLKGLMVSK
Ga0192827_103311913300018763MarinePETFRAQLMTFGNKFSASEVDDAFAEFQIDGGMIDAAHLKGLMVSK
Ga0193396_104846313300018773MarineADAFRHSLMTFGVKFSASEVDDAFAEMKIDEGMIDAAHLKGLMVSK
Ga0192839_103794223300018777MarineFRHSLMTFGNKFSASEVDDAFAEFKIDGGMIDGAHLKGLMVSK
Ga0192832_101366823300018782MarineFGVKFSASEVDDAFAEMKIDEGMIDAAHLKGLMVSK
Ga0193197_106443613300018783MarineMFKHSLMTFGDKFSSSEVDNAFSEFVIEDGMIDAVQLKGLMVSKKEEGEE
Ga0192956_104653513300018792MarineFGNKFSASEVDDAFAEFQIDEGMIDSAALKGLMVAK
Ga0193357_103556113300018794MarineTFGNKFSASEVDDAFAEFQIDGGMIDAAHLKGLMVSK
Ga0192854_107994113300018808MarineHGTFGNKFSASEVDDAFAEFKIDGGMIDAAHLKGLMSS
Ga0192861_103278123300018809MarineHSLMTFGDKFSASEVDDAFAEFKIDGGMIDAAHLKGLMSS
Ga0193412_108262413300018821MarineLMTFGDKFTSSEVDNAFSEFVIEDGMIDAVQLKGLMVSKKEEGEE
Ga0193366_107408413300018827MarineQLMTFGNKFSASEVDDAFAEFKIDDGQIDAAHLKGLMVSK
Ga0193238_106514113300018829MarineDAEAFRHSLMTFGNKFSASEVDDAFGEFKIDGGMIDAAHLKGLMVAK
Ga0193363_109278213300018857MarineGKIDAEMFRHSLMTFGDKFSAQECEDAFAEFQIADGMIDGAHLKGLMVAKK
Ga0192901_106871113300018889MarineIEAEAFRHSLMTFGNKFSAGEVDDAFAEFKIDEGMIDAAHLKGLMVSK
Ga0193160_1003305913300018909MarineLMTFGVKFSAGEVDDAFAEMKIDEGMIDAAHLKGLMVSK
Ga0192987_114002013300018911MarineHSLMTFGNKFSASEVDDAFAEFKIDEGMIDAAHLKGLMVSK
Ga0193109_1011942423300018919MarineGNKFSASEVDDAFAEFKIDGGMIDAAHLKGLMCSQ
Ga0193096_1018525713300018924MarineIDAEAFRHSLMTFGNKFSASEVDDAFAEFKIDGGMIDAAHLKGLMSS
Ga0193318_1010091633300018925MarineAETFRAQLMTFGNKFSASEVDDAFAEFKIDGGMIDAAHLKGLMCSQ
Ga0192921_1016958713300018929MarineMTFGDKFSASECDDAFAEFKIDGGMIDAAHLKDLMAN
Ga0192818_1004775813300018940MarineAEAFRHSLMTFGVKFSAGEVDDAFAEMKIDEGMIDAAHLKGLMVSK
Ga0192818_1009979613300018940MarineTWALMTFGDKFSAAECDDAFAEFKVDGGMIDAAHLKGLMASN
Ga0193066_1010314113300018947MarineHSLMTFGNKFSASEVDDAFAEFQIDGGMIDAAHLKGLMVSK
Ga0193066_1010395913300018947MarineGKIDAETFRAQLMTFGNKFTASEVDDAFAEFQIDGGMIDAAHLKGLMVSK
Ga0193066_1016236623300018947MarineIDAEAFRHSLMTFGNKFSASEVDDAFAEFKIDGGMIDAAHLKGLMCSN
Ga0193066_1016505413300018947MarineIDAEAFRHSLMTFGNKFSASEVDDAFAEFKIDGGMIDAAHLKGLMCSQ
Ga0193010_1003856113300018949MarineHGDAETFRAQLMTFGNKFSASEVDDAFAEFQIDGGMIDAAHLKGLMVSK
Ga0193128_1001360313300018951MarineMTFGDKFTSSEVDNAFSEFVIEDGMIDAVQLKGLMVSKKEEGEE
Ga0193379_1021313013300018955MarineEMFKHSLMTFGDKFSSSEVDNAFSEFVIEDGMIDAVHLKGLMVSKKEEDEG
Ga0193560_1018369413300018958MarineEMDGKIDAEMFRHSLMTFGDKFSAQECEDAFAEFQIADGMIDGAHLKGLMVAKK
Ga0193293_1009300513300018966MarineMFKHSLMTFGDKFSASEVDNAFGEFLIEDGMIDAVHLKGLMVSKKEEEAE
Ga0193143_1006000923300018969MarineMTFGDKFSAQEVEDAFAEFQIDGGMIDGEHLKGLMVAKK
Ga0193417_1019370213300018970MarineDAEAFRHSLMTFGNKFSAAEVDDAFAEFKIDGGMIDAAHLKGLMASN
Ga0193330_1016996213300018973MarineAFRHSLMTFGNKFSASEVDDAFAEFKIDGGMIDAAHLKGLMSS
Ga0192873_1034917213300018974MarineMFKHSLMTFGDKFTSAEVDNAFGEFSIEDGMIDAVQLKGLMVSKKEEGEEA
Ga0193353_1009477713300018977MarineGKIDAETFRAQLMTFGNKFSASEVDDAFAEFQIDGGMIDAAHLKGLMVSK
Ga0193353_1011906313300018977MarineMTFGNKFTASEVDDAFAEFQIDGGMIDAAHLKGLMVSK
Ga0193487_1020172413300018978MarineXKIDAETFRAQLMTFGNKFSASEVDDAFAEFKIDDGQIDAAHLKGLMVSK
Ga0193487_1025345913300018978MarineAETFRAQLMTFGNKFSASEVDDAFAEFKIDGGMIDAAHLKGLMSS
Ga0193540_1008183913300018979MarineEMDGKIDAEAFRHSLMTFGNKFSASEVDEAFAEFKIDGDMIDAAHLKGLMVSK
Ga0192947_1014402613300018982MarineSLMTFGNKFSASEVDEAFAEFKIDEGMLDAASLKGLMVAK
Ga0192947_1027933713300018982MarineSLMTFGNKFSASEVDEAFAEFKIDEGMLDSASLKGLMVAK
Ga0193017_1014061413300018983MarineKIDADAFRHSLMTFGVKFSASEVDDAFAEMKIDEGMIDAAHLKGLMVSK
Ga0193136_1007892713300018985MarineRHSLMTFGVKFSASEVDDAFAEMKIDEGMIDAAHLKGLMVSK
Ga0193275_1011845713300018988MarineTFGDKFSASEVDNAFGEFIIEEGMIDAVHLKGLMVSKKEEEAE
Ga0193275_1012315313300018988MarineTFGDKFSASEVDNAFGEFLIEDGMIDAVHLKGLMVSKKEEEAE
Ga0192916_1012005423300018996MarineDAETFRAQLMTFGNKFSASEVDDAFAEFQIDGGMIDAAHLKGLMVSK
Ga0193444_1014139613300018998MarineMTFGNKFSASEVDDAFAEFKIDGGMIDAAHLKGLMSS
Ga0193514_1013328323300018999MarineMFRHSLMTFGDKFSAQEVEDAFAEFTITDGMIDANHLKGLMVSKKK
Ga0193514_1016178713300018999MarineMFRHSLMTFGDKFSAQEVEDAFAEFQITDGMIDANHLKGLMVSKKK
Ga0193514_1019059013300018999MarineIDAEAFRHSLMTFGNKFSAAEVDDAFAEFKIDGGMIDAAHLKGLMVAK
Ga0193034_1007336523300019001MarineLMTFGVKFSASEVDDAFAEMKIDEGMIDAAHLKGLMVAK
Ga0193078_1005543213300019004MarineQLMTFGNKFSASEVDDAFAEFQIDGGMIDMGHLKGLMVSK
Ga0193044_1015354713300019010MarineEAFRHSLMTFGNKFSASEVDEAFAEFKIDGDTIDAAHLKGLMVSK
Ga0193557_1026494213300019013MarineMTFGDKFSASEVDNAFGEFFIEDGMIDAVHLKGLMVSKKEEEAE
Ga0192951_1019342813300019022MarineFRHSLMTFGVKFSASEVDDAFAEFKIDGGMIDAAHLKGLMVSK
Ga0192998_1014736213300019043MarineTFGDKFSAAEVDNAFGEFVIEDGMIDAAHLKGLMVSKKEEEE
Ga0193459_10073513300019067MarineHSLMAFGVKFSASEVDDAFAEMKIDEGMIDAAHLKGLMVSK
Ga0192836_102806913300019092MarineMTFGDKFSAGEVDDAFGEFQIDGGMIDAAHLKGLMCSK
Ga0192836_102982413300019092MarineEFRHSLMTFGVKFSASEVDDAFAEMKIDEGMIDAAHLKGLMVAK
Ga0193374_100892613300019105MarineALMTFGNKFSASEVDDAFAEFKIDGGMIDAAHLKGLMVSK
Ga0193443_103255213300019115MarineLMTFGDKFSSSEVDNAFSEFVIEDGMIDAVHLKGLMVSKKEEGEE
Ga0193144_105106213300019126MarineIDAEAFRHSLMTFGNKFSASEVDDAFAEFQIDEGMIDGAHLKGLMVSK
Ga0193453_108513913300019147MarineKIDAETFRAQLMAFGNKFTASEVDDAFAEFQIDGGMIDAAHLKGLMVSK
Ga0193239_1016297813300019148MarineLMTFGNKFSASEVDDAFAEFKIDEGMIDAAQLKGLMVSK
Ga0210334_1049808623300021859EstuarineMTWGDKFSAQEVDDAFAEFQIEGGQIDAHHLKGLMVAK
Ga0063109_10475613300021866MarineLMTFGVKFSASEVDDAFAEMKIDEGMIDAAHLKGLMVSK
Ga0063129_10345613300021871MarineTFGVKFSASEVDDAFAEMKIDEGMIDAAHLKGLMVSK
Ga0073937_1002525013300030951MarineMTFGNKFSASEVDDAFAEFKIDEGMIDGAHLKGLMVSK
Ga0073943_1000574523300030955MarineDMFKHSLMTFGDKFSASEVDNAFGEFLIEDGMIDAAHLKGLMVSKKEEEAE
Ga0307393_105471513300031674MarineEMFRHSLMTFGDKFSAQEAEDAFAEFQIEDGMIDGAHLKGLMVAKK
Ga0307393_114802623300031674MarineEMDGKIDAEMFRHSLMTFGDKFSAQEAEDAFAEFQIEDGMIDGAHLKGLMVAKK
Ga0307383_1048300113300031739MarineMTFGVKFSASEVDDAFAEMKIDEGMIDAAHLKGLMVSK
Ga0307382_1013381813300031743MarineMTFGNKFSAGEVDDAFAEFKIDEGMIDAAHLKGLMVSK
Ga0314675_1035197213300032491SeawaterIDAEAFRHSLMTFGNKFSASEVDDAFAEFKIDGGMIDAAHLKGLMVSK
Ga0314675_1060928523300032491SeawaterAEAFRHSLMTFGVKFSASEVDDAFAEMKIDEGMIDAAHLKGLMVSK
Ga0314675_1064786713300032491SeawaterDGEAFRHSLMTFGDKFSSSEVDDAFAEFKVDGGMIDAAHLKGLMCSK
Ga0314688_1051561513300032517SeawaterEAFRHSLMTFGNKFSASEVDDAFAEFKVDEGMIDAAHLKGLMVSK
Ga0314667_1076159113300032520SeawaterDAEAFRHSLMTFGVKFSASEVDDAFAEMKIDEGMIDAAHLKGLMVSK
Ga0314673_1044893513300032650SeawaterAEAFRHSLMTFGNKFSASEVDDAFAEFKVDEGMIDAAHLKGLMVSK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.