Metagenome / Metatranscriptome Family F041156

Basic Information
Family ID	F041156
Family Type	Metagenome / Metatranscriptome
Number of Sequences	160
Average Sequence Length	41 residues
Representative Sequence	VEIDFRSLAVVLTRTAAMLLIAVLLILVLLPAALAASSR
Number of Associated Samples	139
Number of Associated Scaffolds	160

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	42.50 %
% of genes near scaffold ends (potentially truncated)	18.12 %
% of genes from short scaffolds (< 2000 bps)	86.25 %
Associated GOLD sequencing projects	134
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.56

Most Common Taxonomy
Group	Bacteria (94.375 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (15.000 % of family members)
Environment Ontology (ENVO)	Unclassified (25.625 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (43.750 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 50.75% β-sheet: 0.00% Coil/Unstructured: 49.25%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 160 Family Scaffolds
PF02811	PHP	58.12
PF07733	DNA_pol3_alpha	3.75
PF11799	IMS_C	2.50
PF14079	DUF4260	1.25
PF00817	IMS	1.25
PF08241	Methyltransf_11	0.62
PF00072	Response_reg	0.62
PF00154	RecA	0.62
PF01855	POR_N	0.62
PF00772	DnaB	0.62
PF03952	Enolase_N	0.62
PF07859	Abhydrolase_3	0.62
PF00133	tRNA-synt_1	0.62
PF02518	HATPase_c	0.62
PF01850	PIN	0.62
PF00892	EamA	0.62

COG ID	Name	Functional Category	% Frequency in 160 Family Scaffolds
COG0587	DNA polymerase III, alpha subunit	Replication, recombination and repair [L]	3.75
COG2176	DNA polymerase III, alpha subunit (gram-positive type)	Replication, recombination and repair [L]	3.75
COG0389	Nucleotidyltransferase/DNA polymerase DinP involved in DNA repair	Replication, recombination and repair [L]	1.25
COG0060	Isoleucyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.62
COG0143	Methionyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.62
COG0148	Enolase	Carbohydrate transport and metabolism [G]	0.62
COG0305	Replicative DNA helicase	Replication, recombination and repair [L]	0.62
COG0468	RecA/RadA recombinase	Replication, recombination and repair [L]	0.62
COG0495	Leucyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.62
COG0525	Valyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.62
COG0657	Acetyl esterase/lipase	Lipid transport and metabolism [I]	0.62
COG0674	Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, alpha subunit	Energy production and conversion [C]	0.62
COG4231	TPP-dependent indolepyruvate ferredoxin oxidoreductase, alpha subunit	Energy production and conversion [C]	0.62

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	94.38 %
Unclassified	root	N/A	5.62 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	94.38 %
Unclassified	root	N/A	5.62 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	94.38 %
Unclassified	root	N/A	5.62 %

Name	Rank	Taxonomy	Distribution
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	55.00 %
Unclassified	root	N/A	5.62 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.62 %

Name	Rank	Taxonomy	Distribution
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	51.25 %
Unclassified	root	N/A	5.62 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3.75 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.62 %

Name	Rank	Taxonomy	Distribution
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	36.25 %
Unclassified	root	N/A	5.62 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	2.50 %
Thermomicrobia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia	1.25 %
unclassified Gemmatimonadetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes	0.62 %

Name	Rank	Taxonomy	Distribution
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	36.25 %
Unclassified	root	N/A	5.62 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	2.50 %
Sphaerobacteridae	subclass	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae	1.25 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.62 %

Name	Rank	Taxonomy	Distribution
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	36.25 %
Unclassified	root	N/A	5.62 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	2.50 %
Sphaerobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales	1.25 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.62 %

Name	Rank	Taxonomy	Distribution
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	36.25 %
Unclassified	root	N/A	5.62 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	2.50 %
Sphaerobacterineae	suborder	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae	1.25 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.62 %

Name	Rank	Taxonomy	Distribution
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	36.25 %
Unclassified	root	N/A	5.62 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	2.50 %
Sphaerobacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae	1.25 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.62 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000033\|ICChiseqgaiiDRAFT_c0894665	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	602	Open in IMG/M
3300000033\|ICChiseqgaiiDRAFT_c0894673	All Organisms → cellular organisms → Bacteria	592	Open in IMG/M
3300001330\|A305W6_1002199	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	2185	Open in IMG/M
3300001535\|A3PFW1_10020236	All Organisms → cellular organisms → Bacteria	783	Open in IMG/M
3300003267\|soilL1_10024917	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1905	Open in IMG/M
3300003324\|soilH2_10022942	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	7047	Open in IMG/M
3300003996\|Ga0055467_10289759	Not Available	522	Open in IMG/M
3300004114\|Ga0062593_100251462	All Organisms → cellular organisms → Bacteria	1461	Open in IMG/M
3300004114\|Ga0062593_100672417	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	1004	Open in IMG/M
3300004156\|Ga0062589_101120748	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	746	Open in IMG/M
3300004157\|Ga0062590_100094258	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae	1870	Open in IMG/M
3300004157\|Ga0062590_100997575	All Organisms → cellular organisms → Bacteria	796	Open in IMG/M
3300004463\|Ga0063356_100145135	All Organisms → cellular organisms → Bacteria	2692	Open in IMG/M
3300004479\|Ga0062595_100145558	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	1367	Open in IMG/M
3300004479\|Ga0062595_102200922	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	540	Open in IMG/M
3300004480\|Ga0062592_100323916	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1181	Open in IMG/M
3300004480\|Ga0062592_101246934	All Organisms → cellular organisms → Bacteria	698	Open in IMG/M
3300004643\|Ga0062591_101737874	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	634	Open in IMG/M
3300005093\|Ga0062594_101419355	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	706	Open in IMG/M
3300005180\|Ga0066685_10380026	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	981	Open in IMG/M
3300005181\|Ga0066678_10226027	All Organisms → cellular organisms → Bacteria	1203	Open in IMG/M
3300005331\|Ga0070670_101702632	All Organisms → cellular organisms → Bacteria	580	Open in IMG/M
3300005332\|Ga0066388_102277113	All Organisms → cellular organisms → Bacteria	980	Open in IMG/M
3300005335\|Ga0070666_10763483	All Organisms → cellular organisms → Bacteria	711	Open in IMG/M
3300005336\|Ga0070680_100000012	All Organisms → cellular organisms → Bacteria	93956	Open in IMG/M
3300005336\|Ga0070680_100497818	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1042	Open in IMG/M
3300005338\|Ga0068868_102135866	All Organisms → cellular organisms → Bacteria	533	Open in IMG/M
3300005343\|Ga0070687_101381847	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	526	Open in IMG/M
3300005406\|Ga0070703_10618399	All Organisms → cellular organisms → Bacteria	502	Open in IMG/M
3300005437\|Ga0070710_10190893	All Organisms → cellular organisms → Bacteria	1288	Open in IMG/M
3300005440\|Ga0070705_101144746	All Organisms → cellular organisms → Bacteria	639	Open in IMG/M
3300005450\|Ga0066682_10613872	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	681	Open in IMG/M
3300005468\|Ga0070707_100080988	All Organisms → cellular organisms → Bacteria	3134	Open in IMG/M
3300005539\|Ga0068853_100822621	All Organisms → cellular organisms → Bacteria	890	Open in IMG/M
3300005549\|Ga0070704_100247350	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae	1462	Open in IMG/M
3300005558\|Ga0066698_10641344	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	710	Open in IMG/M
3300005577\|Ga0068857_100514132	All Organisms → cellular organisms → Bacteria	1125	Open in IMG/M
3300005764\|Ga0066903_107867961	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	548	Open in IMG/M
3300005830\|Ga0074473_10850846	All Organisms → cellular organisms → Bacteria	800	Open in IMG/M
3300005938\|Ga0066795_10247710	All Organisms → cellular organisms → Bacteria	527	Open in IMG/M
3300005985\|Ga0081539_10322087	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	657	Open in IMG/M
3300006640\|Ga0075527_10179709	All Organisms → cellular organisms → Bacteria	604	Open in IMG/M
3300006755\|Ga0079222_11996193	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	570	Open in IMG/M
3300006847\|Ga0075431_101073732	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	770	Open in IMG/M
3300006876\|Ga0079217_10124181	All Organisms → cellular organisms → Bacteria	1204	Open in IMG/M
3300006914\|Ga0075436_100607968	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	806	Open in IMG/M
3300007076\|Ga0075435_101633230	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	565	Open in IMG/M
3300009092\|Ga0105250_10225121	All Organisms → cellular organisms → Bacteria	796	Open in IMG/M
3300009094\|Ga0111539_11468357	All Organisms → cellular organisms → Bacteria	791	Open in IMG/M
3300009147\|Ga0114129_10215496	All Organisms → cellular organisms → Bacteria	2593	Open in IMG/M
3300009147\|Ga0114129_12440642	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	626	Open in IMG/M
3300009162\|Ga0075423_10163725	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	2335	Open in IMG/M
3300009162\|Ga0075423_10327773	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1605	Open in IMG/M
3300009162\|Ga0075423_12436622	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	571	Open in IMG/M
3300009174\|Ga0105241_12522055	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	515	Open in IMG/M
3300009176\|Ga0105242_10915462	All Organisms → cellular organisms → Bacteria	878	Open in IMG/M
3300009177\|Ga0105248_10487155	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1390	Open in IMG/M
3300009789\|Ga0126307_10131123	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	2001	Open in IMG/M
3300010042\|Ga0126314_10970984	Not Available	630	Open in IMG/M
3300010044\|Ga0126310_10024998	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	3053	Open in IMG/M
3300010045\|Ga0126311_10175295	All Organisms → cellular organisms → Bacteria	1547	Open in IMG/M
3300010045\|Ga0126311_11309520	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	602	Open in IMG/M
3300010047\|Ga0126382_12505983	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	503	Open in IMG/M
3300010333\|Ga0134080_10129593	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1057	Open in IMG/M
3300010362\|Ga0126377_10379530	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1418	Open in IMG/M
3300010375\|Ga0105239_10408711	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1537	Open in IMG/M
3300010391\|Ga0136847_10200770	All Organisms → cellular organisms → Bacteria	553	Open in IMG/M
3300010397\|Ga0134124_10090029	All Organisms → cellular organisms → Bacteria	2653	Open in IMG/M
3300010399\|Ga0134127_10038139	All Organisms → cellular organisms → Bacteria	3896	Open in IMG/M
3300010399\|Ga0134127_12970132	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	553	Open in IMG/M
3300010399\|Ga0134127_13495578	Not Available	515	Open in IMG/M
3300011003\|Ga0138514_100035155	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	965	Open in IMG/M
3300011119\|Ga0105246_10260985	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1380	Open in IMG/M
3300011987\|Ga0120164_1019086	All Organisms → cellular organisms → Bacteria	1155	Open in IMG/M
3300012001\|Ga0120167_1053874	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	877	Open in IMG/M
3300012008\|Ga0120174_1135738	All Organisms → cellular organisms → Bacteria	586	Open in IMG/M
3300012046\|Ga0136634_10221148	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	755	Open in IMG/M
3300012469\|Ga0150984_100176805	All Organisms → cellular organisms → Bacteria	1951	Open in IMG/M
3300012519\|Ga0157352_1051351	All Organisms → cellular organisms → Bacteria	615	Open in IMG/M
3300012668\|Ga0157216_10130457	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1217	Open in IMG/M
3300012685\|Ga0137397_10095367	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	2176	Open in IMG/M
3300012931\|Ga0153915_10113729	All Organisms → cellular organisms → Bacteria	2892	Open in IMG/M
3300012955\|Ga0164298_11587194	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	515	Open in IMG/M
3300012957\|Ga0164303_11120874	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	569	Open in IMG/M
3300012972\|Ga0134077_10200671	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	813	Open in IMG/M
3300013100\|Ga0157373_10335931	All Organisms → cellular organisms → Bacteria	1076	Open in IMG/M
3300013297\|Ga0157378_11984354	All Organisms → cellular organisms → Bacteria	632	Open in IMG/M
3300014269\|Ga0075302_1160055	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	552	Open in IMG/M
3300014497\|Ga0182008_10146404	All Organisms → cellular organisms → Bacteria	1183	Open in IMG/M
3300015079\|Ga0167657_1007524	All Organisms → cellular organisms → Bacteria	1568	Open in IMG/M
3300015086\|Ga0167655_1010441	All Organisms → cellular organisms → Bacteria	1759	Open in IMG/M
3300015261\|Ga0182006_1142156	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	819	Open in IMG/M
3300015358\|Ga0134089_10439525	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	563	Open in IMG/M
3300015371\|Ga0132258_13634000	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1054	Open in IMG/M
3300015372\|Ga0132256_103141974	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	555	Open in IMG/M
3300015373\|Ga0132257_103367936	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	582	Open in IMG/M
3300015374\|Ga0132255_101357105	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1073	Open in IMG/M
3300017789\|Ga0136617_10701249	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	785	Open in IMG/M
3300017792\|Ga0163161_11453644	All Organisms → cellular organisms → Bacteria	600	Open in IMG/M
3300018000\|Ga0184604_10314926	Not Available	554	Open in IMG/M
3300018028\|Ga0184608_10161510	All Organisms → cellular organisms → Bacteria	970	Open in IMG/M
3300018054\|Ga0184621_10091445	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1068	Open in IMG/M
3300018066\|Ga0184617_1161434	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	661	Open in IMG/M
3300018422\|Ga0190265_10107785	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	2630	Open in IMG/M
3300018432\|Ga0190275_12448870	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	600	Open in IMG/M
3300018433\|Ga0066667_12059072	Not Available	527	Open in IMG/M
3300018465\|Ga0190269_10603718	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	742	Open in IMG/M
3300018466\|Ga0190268_10509101	Not Available	820	Open in IMG/M
3300018469\|Ga0190270_11051018	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	844	Open in IMG/M
3300018469\|Ga0190270_11142922	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	814	Open in IMG/M
3300018920\|Ga0190273_11581359	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	584	Open in IMG/M
3300019361\|Ga0173482_10611472	All Organisms → cellular organisms → Bacteria	549	Open in IMG/M
3300019377\|Ga0190264_11752446	Not Available	556	Open in IMG/M
3300019767\|Ga0190267_10106888	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1127	Open in IMG/M
3300019885\|Ga0193747_1020538	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1622	Open in IMG/M
3300019887\|Ga0193729_1052091	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1660	Open in IMG/M
3300019999\|Ga0193718_1046803	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	945	Open in IMG/M
3300020202\|Ga0196964_10515161	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	585	Open in IMG/M
3300021329\|Ga0210362_1282467	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	771	Open in IMG/M
3300021859\|Ga0210334_10413170	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	977	Open in IMG/M
3300024181\|Ga0247693_1013532	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1049	Open in IMG/M
3300025160\|Ga0209109_10260847	All Organisms → cellular organisms → Bacteria	838	Open in IMG/M
3300025907\|Ga0207645_10077224	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	2134	Open in IMG/M
3300025912\|Ga0207707_10120916	All Organisms → cellular organisms → Bacteria	2289	Open in IMG/M
3300025917\|Ga0207660_10000002	All Organisms → cellular organisms → Bacteria	883566	Open in IMG/M
3300025917\|Ga0207660_10485052	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1002	Open in IMG/M
3300025917\|Ga0207660_10720852	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	814	Open in IMG/M
3300025921\|Ga0207652_11824761	All Organisms → cellular organisms → Bacteria	513	Open in IMG/M
3300025922\|Ga0207646_10016299	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	6974	Open in IMG/M
3300025922\|Ga0207646_11291681	All Organisms → cellular organisms → Bacteria	637	Open in IMG/M
3300025923\|Ga0207681_10932291	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	728	Open in IMG/M
3300025927\|Ga0207687_10138376	Not Available	1844	Open in IMG/M
3300025933\|Ga0207706_10597147	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	948	Open in IMG/M
3300025934\|Ga0207686_10627986	All Organisms → cellular organisms → Bacteria	848	Open in IMG/M
3300025960\|Ga0207651_11979488	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	524	Open in IMG/M
3300025981\|Ga0207640_10540383	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	977	Open in IMG/M
3300026067\|Ga0207678_10937971	All Organisms → cellular organisms → Bacteria	766	Open in IMG/M
3300026116\|Ga0207674_11629990	All Organisms → cellular organisms → Bacteria	614	Open in IMG/M
3300027876\|Ga0209974_10087657	All Organisms → cellular organisms → Bacteria	1077	Open in IMG/M
3300027876\|Ga0209974_10270480	All Organisms → cellular organisms → Bacteria	644	Open in IMG/M
3300027876\|Ga0209974_10407080	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	535	Open in IMG/M
3300028807\|Ga0307305_10278006	All Organisms → cellular organisms → Bacteria	763	Open in IMG/M
3300028814\|Ga0307302_10013132	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	3710	Open in IMG/M
3300028824\|Ga0307310_10038367	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1958	Open in IMG/M
3300028828\|Ga0307312_11078459	All Organisms → cellular organisms → Bacteria	531	Open in IMG/M
3300028881\|Ga0307277_10276364	All Organisms → cellular organisms → Bacteria	743	Open in IMG/M
3300028884\|Ga0307308_10352830	All Organisms → cellular organisms → Bacteria	704	Open in IMG/M
3300028885\|Ga0307304_10045611	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1605	Open in IMG/M
3300028885\|Ga0307304_10546841	All Organisms → cellular organisms → Bacteria	533	Open in IMG/M
3300029304\|Ga0119857_1003886	All Organisms → cellular organisms → Bacteria	3585	Open in IMG/M
3300030336\|Ga0247826_10195130	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1380	Open in IMG/M
3300031229\|Ga0299913_10251673	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1750	Open in IMG/M
3300031716\|Ga0310813_11442323	All Organisms → cellular organisms → Bacteria	639	Open in IMG/M
3300032002\|Ga0307416_100085586	All Organisms → cellular organisms → Bacteria	2684	Open in IMG/M
3300032002\|Ga0307416_103011232	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	564	Open in IMG/M
3300032205\|Ga0307472_102095173	All Organisms → cellular organisms → Bacteria	569	Open in IMG/M
3300032782\|Ga0335082_10108895	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	2734	Open in IMG/M
3300032782\|Ga0335082_11060754	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	676	Open in IMG/M
3300033004\|Ga0335084_10241292	Not Available	1874	Open in IMG/M
3300034125\|Ga0370484_0054421	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	997	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	70.62%
Host-Associated	Host-Associated	28.75%
Engineered	Engineered	0.62%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	63.12%
Plants	Host-Associated → Plants	28.75%
Aquatic	Environmental → Aquatic	7.50%
Bioreactor	Engineered → Bioreactor	0.62%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	62.50%
Rhizosphere	Host-Associated → Plants → Rhizosphere	20.00%
Rhizoplane	Host-Associated → Plants → Rhizoplane	8.75%
Sediment	Environmental → Aquatic → Sediment	3.12%
Freshwater	Environmental → Aquatic → Freshwater	2.50%
Marine	Environmental → Aquatic → Marine	1.88%
Agricultural Field	Environmental → Terrestrial → Agricultural Field	0.62%
Unclassified	Engineered → Bioreactor → Unclassified	0.62%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	47.50%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	14.37%
Loam	Environmental → Terrestrial → Soil → Loam	10.62%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	6.88%
Soil	Host-Associated → Plants → Rhizosphere → Soil	5.62%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	3.12%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	3.75%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.88%
Ice	Environmental → Aquatic → Freshwater → Ice	1.25%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	1.25%
Lake	Environmental → Aquatic → Freshwater → Lake	0.62%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.62%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.62%
Sand	Environmental → Terrestrial → Soil → Sand	0.62%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified	0.62%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified	0.62%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	27.50%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	14.37%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	9.38%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	9.38%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	6.88%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	5.62%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	4.38%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	3.12%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	3.12%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	3.75%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.88%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	1.25%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	1.25%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	1.25%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.25%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.62%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.62%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.62%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.62%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	0.62%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	0.62%
Desert	Environmental → Terrestrial → Soil → Sand → Desert	0.62%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified	0.62%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified	0.62%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	15.00%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	6.88%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	5.62%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.38%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	4.38%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	3.12%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	3.12%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.75%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	2.50%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.50%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	2.50%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	2.50%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.50%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.50%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	1.88%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	1.88%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	1.88%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.88%
Polar Desert Sand	Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand	1.25%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	1.25%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	1.25%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.25%
Sugarcane Root And Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil	1.25%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.25%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	1.25%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.25%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.25%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	1.25%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.25%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment	0.62%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.62%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.62%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	0.62%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.62%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	0.62%
Unplanted Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil	0.62%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	0.62%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.62%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.62%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.62%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.62%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	0.62%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	0.62%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.62%
Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil	0.62%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.62%
Soil	Environmental → Terrestrial → Soil → Sand → Desert → Soil	0.62%
Soil	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil	0.62%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.62%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.62%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.62%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.62%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.62%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.62%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.62%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.62%
Anaerobic Bioreactor	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Anaerobic Bioreactor	0.62%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000033	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300001330	Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-5cm)- 6 month illumina	Environmental	Open in IMG/M
3300001535	Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina	Environmental	Open in IMG/M
3300003267	Sugarcane bulk soil Sample L1	Environmental	Open in IMG/M
3300003324	Sugarcane bulk soil Sample H2	Environmental	Open in IMG/M
3300003996	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental	Open in IMG/M
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005180	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134	Environmental	Open in IMG/M
3300005181	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127	Environmental	Open in IMG/M
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated	Open in IMG/M
3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Environmental	Open in IMG/M
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated	Open in IMG/M
3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Environmental	Open in IMG/M
3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Environmental	Open in IMG/M
3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Environmental	Open in IMG/M
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental	Open in IMG/M
3300005450	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131	Environmental	Open in IMG/M
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental	Open in IMG/M
3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Host-Associated	Open in IMG/M
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental	Open in IMG/M
3300005558	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147	Environmental	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005830	Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM	Environmental	Open in IMG/M
3300005938	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191	Environmental	Open in IMG/M
3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Host-Associated	Open in IMG/M
3300006640	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B	Environmental	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006876	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200	Environmental	Open in IMG/M
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Host-Associated	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009789	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28	Environmental	Open in IMG/M
3300010042	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B	Environmental	Open in IMG/M
3300010044	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60	Environmental	Open in IMG/M
3300010045	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010333	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010391	Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300011003	Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015	Environmental	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300011987	Permafrost microbial communities from Nunavut, Canada - A20_80cm_0M	Environmental	Open in IMG/M
3300012001	Permafrost microbial communities from Nunavut, Canada - A24_80cm_12M	Environmental	Open in IMG/M
3300012008	Permafrost microbial communities from Nunavut, Canada - A39_80cm_12M	Environmental	Open in IMG/M
3300012046	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ833 (21.06)	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012519	Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610	Environmental	Open in IMG/M
3300012668	Arctic soils microbial communities. Combined Assembly of 23 SPs	Environmental	Open in IMG/M
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental	Open in IMG/M
3300012931	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG	Environmental	Open in IMG/M
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300012972	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG	Environmental	Open in IMG/M
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300014269	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1	Environmental	Open in IMG/M
3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Host-Associated	Open in IMG/M
3300015079	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6b, vegetation/snow interface)	Environmental	Open in IMG/M
3300015086	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-5c, rocky medial moraine)	Environmental	Open in IMG/M
3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Host-Associated	Open in IMG/M
3300015358	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300017789	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06)	Environmental	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300018000	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex	Environmental	Open in IMG/M
3300018028	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex	Environmental	Open in IMG/M
3300018054	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1	Environmental	Open in IMG/M
3300018066	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1	Environmental	Open in IMG/M
3300018422	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T	Environmental	Open in IMG/M
3300018432	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018465	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS	Environmental	Open in IMG/M
3300018466	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300018920	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS	Environmental	Open in IMG/M
3300019361	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)	Environmental	Open in IMG/M
3300019377	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T	Environmental	Open in IMG/M
3300019767	Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T	Environmental	Open in IMG/M
3300019885	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2	Environmental	Open in IMG/M
3300019887	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2	Environmental	Open in IMG/M
3300019999	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1	Environmental	Open in IMG/M
3300020202	Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10	Environmental	Open in IMG/M
3300021329	Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.625 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021859	Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.306 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300024181	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34	Environmental	Open in IMG/M
3300025160	Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2	Environmental	Open in IMG/M
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)	Host-Associated	Open in IMG/M
3300028807	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186	Environmental	Open in IMG/M
3300028814	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183	Environmental	Open in IMG/M
3300028824	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197	Environmental	Open in IMG/M
3300028828	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202	Environmental	Open in IMG/M
3300028881	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116	Environmental	Open in IMG/M
3300028884	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195	Environmental	Open in IMG/M
3300028885	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185	Environmental	Open in IMG/M
3300029304	Anaerobic bioreactor microbial community of Freshwater lake and wastewater samples from Australia - AOM-metagenome-Illumina	Engineered	Open in IMG/M
3300030336	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1	Environmental	Open in IMG/M
3300031229	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38	Environmental	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Host-Associated	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300032782	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1	Environmental	Open in IMG/M
3300033004	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4	Environmental	Open in IMG/M
3300034125	Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
ICChiseqgaiiDRAFT_08946651	3300000033	Soil	VETDQRTWAAVLTRTLAMLFVASLLILVLLPAALAASSR*
ICChiseqgaiiDRAFT_08946732	3300000033	Soil	MEIDVRSLAVVMTRTTAMLLLASLLILVLLPAALAAXXR*
A305W6_10021992	3300001330	Permafrost	VGTDFRNLAVVLTRTTAMLLLAVLLILVILPAALAASSR*
A3PFW1_100202361	3300001535	Permafrost	VLSLATKHPDGMSRQRAVDQDLRTLAVVMTRTAAMLLLAVLLILVLLPAALAASGH*
soilL1_100249173	3300003267	Sugarcane Root And Bulk Soil	VETDLRSLAVTLTRTAAMLLLAGLLILVLLPAALAASGR*
soilH2_100229428	3300003324	Sugarcane Root And Bulk Soil	MAGASRLTAVEIDVRSLAVALTRTTAALLVAGLLILVLLPAALAANGR*
Ga0055467_102897591	3300003996	Natural And Restored Wetlands	VDINFRSLAVVLTRTAAMLFIAVLLILVLLPAALAASGR*
Ga0062593_1002514623	3300004114	Soil	VEIDQRTWAAVLARTVAMLFVASLLILVLLPAALAASGR*
Ga0062593_1006724172	3300004114	Soil	VEIDFRSLAVVLTRTAAMLLIAVLLILVLLPAALAASSR*
Ga0062589_1011207481	3300004156	Soil	MEIDVRSLAVVMTRTTAMLLLASLLILVLLPAALAANSR*
Ga0062590_1000942581	3300004157	Soil	WRLRAVEIDQRTWAAVLARTVAMLFVASLLILVLLPAALAASGR*
Ga0062590_1009975752	3300004157	Soil	MSSRLRAVEIDVRSLAAVLTRTAAMLLIAVLLILVLLPAALAASSR*
Ga0063356_1001451355	3300004463	Arabidopsis Thaliana Rhizosphere	MAVETNLRSLAVVLTRTTAMLLLAGLLILVLLPAALAASGQ*
Ga0062595_1001455582	3300004479	Soil	VGTDYRNLAVVLTRTTAMLLLAVLLILVILPAALAASSH*
Ga0062595_1022009221	3300004479	Soil	VGIDYRNLAVALTRTTAMLLLAVLLILVVLPAALAASGR*
Ga0062592_1003239163	3300004480	Soil	VEIDLRSLVVDMTRTTAMLLIAGLLILVLLPAALAANGR*
Ga0062592_1012469341	3300004480	Soil	VETDFRQLAVVMTRTAAMLLIAVLLILVLLPAALAANGT*
Ga0062591_1017378742	3300004643	Soil	VETEPRSLAAVVTRTAVMLVLAVLLILVLLPAALAASAR*
Ga0062594_1014193551	3300005093	Soil	MAVETDIRNLAVVLTRTAAMLLLAGLLILVLLPAVLAASSR*
Ga0066685_103800262	3300005180	Soil	VETDPRSLAAVLTRTAAMLLLAVLLILVLLPAALAASSR*
Ga0066678_102260272	3300005181	Soil	VGSRLTGVAIDPRSLAVVLTRTTAMLLIAGLLILVLLPAALAANGR*
Ga0070670_1017026321	3300005331	Switchgrass Rhizosphere	VDLDLRALATDVTKTAAMLLLAVLLVLVLLPAALAANGG*
Ga0066388_1022771133	3300005332	Tropical Forest Soil	VESDLRSLAVVLTRTTAALLVAGLLILVLLPAALAANGR*
Ga0070666_107634833	3300005335	Switchgrass Rhizosphere	RLRAVEIDIRNLAVDLTRTTAMLLIAGLLILVLLPAALAANGR*
Ga0070680_10000001275	3300005336	Corn Rhizosphere	VEIDFRSLAVVMTRTSAMLLFAALLILVLLPAALAANSR*
Ga0070680_1004978182	3300005336	Corn Rhizosphere	VEIDLRSFVVDMTRTTAMLLIAGLLILVLLPAALAANGR*
Ga0068868_1021358662	3300005338	Miscanthus Rhizosphere	AVEIDVRSLAAVLTRTAAMLLIAVLLILVLLPAALAASSR*
Ga0070687_1013818471	3300005343	Switchgrass Rhizosphere	MPGACRLRAVEIDVRSLATVMTRTAAMLLFAGLLILVLLPAALAANGR*
Ga0070703_106183992	3300005406	Corn, Switchgrass And Miscanthus Rhizosphere	PRLRAVEIDIRSLAAVLTRTAAMLLIAVLLILVLLPAALAASSR*
Ga0070710_101908932	3300005437	Corn, Switchgrass And Miscanthus Rhizosphere	MAVGTDLVGLAAVTTRTIAMLLLAILLILVLLPAALAASAT*
Ga0070705_1011447462	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	VEIDIRSLAAVLTRTAAMLLIAVLLILVLLPAALAASSR*
Ga0066682_106138722	3300005450	Soil	VETDPRSLAAVLTRTAAMLLIAVLLILVLLPAALAASSR*
Ga0070707_1000809882	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	VEIDVRSLATVMTRTAAMLLFAGLLILVLLPAAVAANAR*
Ga0068853_1008226212	3300005539	Corn Rhizosphere	VAIDLRSLVVDMTRTTAMLLIAGLLILVLLPAALAANGR*
Ga0070704_1002473501	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	VEIDVRSLAAVLTRTAAMLLIAVLLILVLLPAALAASSR*
Ga0066698_106413442	3300005558	Soil	VEISPRSLAVVLTRTTAMLLIAGLLILVLLPAALAANGR*
Ga0068857_1005141322	3300005577	Corn Rhizosphere	MDFRQLAVVMTRTAAMLLIAVLLILVLLPAALAANGT*
Ga0066903_1078679611	3300005764	Tropical Forest Soil	VEIDLRNLAVVMTRTTAALLVAGLLILVLLPAALAANGR*
Ga0074473_108508462	3300005830	Sediment (Intertidal)	VEIDPRSLAAVVTRTAAMLLLAVLLILVLLPAALAASSR*
Ga0066795_102477102	3300005938	Soil	MSRQRAVDQDLRNLAVVMTRTAAMLLLAVLLILGLLPAALAASGH*
Ga0081539_103220872	3300005985	Tabebuia Heterophylla Rhizosphere	VEIDYRSLAVVLTRTTASLLLAGLLILVLLPAALAASSR*
Ga0075527_101797092	3300006640	Arctic Peat Soil	VDPDLRSLAAVLTRTAAMLLLAVLLILVLLPAALAANGA*
Ga0079222_119961932	3300006755	Agricultural Soil	VETDTRSWVAVLTRTAAMLFIAVLLILVLLPAALAASGR*
Ga0075431_1010737322	3300006847	Populus Rhizosphere	VENDHRSPAAVLTRTAATLLVAVLLILVLLPAVLAASGR*
Ga0079217_101241812	3300006876	Agricultural Soil	VDTDPRSLTVVLTRTAAMLLFAALLILVLLPAVLAASSR*
Ga0075436_1006079681	3300006914	Populus Rhizosphere	VGTDFRNLAVVLTRTTAMLLLAVLLILVVLPAALAASGR*
Ga0075435_1016332301	3300007076	Populus Rhizosphere	MSSRLRAVEIDIRSLAAVLTRTAAMLLIAVLLILVLLPAALAASSR*
Ga0105250_102251212	3300009092	Switchgrass Rhizosphere	VEIDIRNLAVDLTRTTAMLLIAGLLILVLLPAALAANGR*
Ga0111539_114683571	3300009094	Populus Rhizosphere	KPRGHRLRAVEIDLRSLVVDMTRTTAMLLIAGLLILVLLPAALAANGR*
Ga0114129_102154963	3300009147	Populus Rhizosphere	LAVETDIRNLAVVLTRTAAMLLLAGLLILVLLPAALAASAR*
Ga0114129_124406422	3300009147	Populus Rhizosphere	VETDLRSLTAVLTRTAAMLLIAVLLILVLLPAALAASSR*
Ga0075423_101637254	3300009162	Populus Rhizosphere	VEIDPRNLAVVLTRTTAMLLIAGLLILVLLPAVLAANGR*
Ga0075423_103277733	3300009162	Populus Rhizosphere	RSLAAVLTRTAAMLLIAVLLILVLLPAALAASSR*
Ga0075423_124366221	3300009162	Populus Rhizosphere	VEIDIRSLAAVLTRTTAMLLIAALLILVLLPAALAASVR*
Ga0105241_125220552	3300009174	Corn Rhizosphere	VEIDVRSLAAVLTRTAAMLLIAVLLILVLLPAALAANGR*
Ga0105242_109154621	3300009176	Miscanthus Rhizosphere	VEIDLRNLAVVLTRTTAMLLIAGLLILVLLPAALAANGR*
Ga0105248_104871553	3300009177	Switchgrass Rhizosphere	VEIDVRSLATVMTRTAAMLLFAGLLILVLLPAALAANGR*
Ga0126307_101311232	3300009789	Serpentine Soil	VEIEPRNVAAVLTRTAAMLLIAVLLILVLLPAALAASAR*
Ga0126314_109709842	3300010042	Serpentine Soil	TAVEIEPRNVAAVLTRTAAMLLIAVLLILVLLPAALAASAR*
Ga0126310_100249982	3300010044	Serpentine Soil	MAVETDVRSLAVALTRTAAMLLLAGLLILVLLPAALAASGR*
Ga0126311_101752953	3300010045	Serpentine Soil	VETDQRSWTAVMTRTIAMLFIASLLILVLLPAALAASGR*
Ga0126311_113095202	3300010045	Serpentine Soil	MAVETDVRSLAVALTRTAAMLLLAGLLILVLLPAALAASSR*
Ga0126382_125059832	3300010047	Tropical Forest Soil	VEIDLRNLAVVLTRTTAMLLIAGLLILVLLPAAVAANGR*
Ga0134080_101295932	3300010333	Grasslands Soil	VETDPRSLAAVLTRTAAMLLLAVLLILVLLPAALVASSR*
Ga0126377_103795302	3300010362	Tropical Forest Soil	MRRLRAVEIDVRSLAVVMTRTTAMLLFAALLILVLLPAALVANSR*
Ga0105239_104087113	3300010375	Corn Rhizosphere	VEIDFRNLAVDLTRTTAMLLIAGLLILVLLPAALAANGR*
Ga0136847_102007701	3300010391	Freshwater Sediment	VDLNLRHLAVDMTRTTAMLLLAVLLILVLLPAAVAANGH*
Ga0134124_100900292	3300010397	Terrestrial Soil	MGRPRLKAVGTDFRNLAVVLTRTTAMLLLAVLLILVILPAALAASSR*
Ga0134127_100381391	3300010399	Terrestrial Soil	AQHKSGEPRLRAVEIDFRNLAAVMTRTTAMLLIAGLLILVLLPAALAANGR*
Ga0134127_129701322	3300010399	Terrestrial Soil	VDIDNRSLAAVLTRTAAMLLIAVLLILVLLPAVLAASNR*
Ga0134127_134955781	3300010399	Terrestrial Soil	RSLATVLTRTAASLLIAALLILVLLPAALAASNR*
Ga0138514_1000351552	3300011003	Soil	VETDPRSLAAVLTRTAAMLLIAVLLILVLLPAALAANSR*
Ga0105246_102609852	3300011119	Miscanthus Rhizosphere	MSSRLRAVEIDVRSLAAVLTRTAAMLLIAVLLILVLLPAA
Ga0120164_10190862	3300011987	Permafrost	MSRQRAVDQDLRTLAVVMTRTAAMLLLAVLLILVLLPAALAASGN*
Ga0120167_10538742	3300012001	Permafrost	MSRQRAVDQDLRTLAVVMTRTAAMLLLAVLLILVLLPAALAASGH*
Ga0120174_11357382	3300012008	Permafrost	MWRQRAVDQDLRTLAVVMTRTAAMLLLAVLLILVLLPAALAASGN*
Ga0136634_102211481	3300012046	Polar Desert Sand	DPRSLTAVLTRTAAMLLIAALLILVLLPAVLAASSR*
Ga0150984_1001768053	3300012469	Avena Fatua Rhizosphere	DFRSLAVVMTRTTAMLLLASLLILVLLPAALVANSR*
Ga0157352_10513513	3300012519	Unplanted Soil	LVEIDFRSLAVVLTRTAAMLLIAVLLILVLLPAALAASSR*
Ga0157216_101304572	3300012668	Glacier Forefield Soil	VDINLRSLAAVLTRTAAMLLIAVLLILVLLPAALAASAR*
Ga0137397_100953672	3300012685	Vadose Zone Soil	VEIDFRSLAAVLTRTAAMLLIAVLLILVLLPAALAASSR*
Ga0153915_101137292	3300012931	Freshwater Wetlands	MAVGTDLRSLAVVMTRTVVMLLIATLLILVLLPAALAANGA*
Ga0164298_115871941	3300012955	Soil	VGTDFRNLAVVLTRTTAMLLLAVLLILVILPAALAASGR*
Ga0164303_111208741	3300012957	Soil	VWRLTGVDLNLRHLAADMTRTTAMLLLAVLLILVILPAALAASGR*
Ga0134077_102006712	3300012972	Grasslands Soil	VEISPRSLAVVLTRTTAMLLIAGLLILVLLPAALAASSR*
Ga0157373_103359312	3300013100	Corn Rhizosphere	VDTDARTLATDMTRTIATLLLAILSILVLLPAALAANGA*
Ga0157378_119843543	3300013297	Miscanthus Rhizosphere	RAVEIDIRNLAVDLTRTTAMLLIAGLLILVLLPAALAANGR*
Ga0075302_11600552	3300014269	Natural And Restored Wetlands	MDVRSLAAVVTRTAVMLLIAVLLILVLLPAALAANSR*
Ga0182008_101464042	3300014497	Rhizosphere	VDLDFRALAADMTRTAAMLLLAVLLVLVLLPAALAANGA*
Ga0167657_10075242	3300015079	Glacier Forefield Soil	MSRQRAVDQDLRTLAVVMTRTAAMLLLAVLLILGLLPVALAASGN*
Ga0167655_10104413	3300015086	Glacier Forefield Soil	MSRQRAVDQDLRTLAVVMTRTAAMLLLAVLLILGLLPAALAASGN*
Ga0182006_11421563	3300015261	Rhizosphere	VEIDFRSLAVVLTRTTAMLLVAGLLILVLLPAALAANVR*
Ga0134089_104395252	3300015358	Grasslands Soil	VEISPRSLAVVLTRTAAMLLIAGLLILVLLPAALAANGR*
Ga0132258_136340001	3300015371	Arabidopsis Rhizosphere	VEIDLRNLAVVLTRTTAMLLIAGLLILVLLPAVLAANGR*
Ga0132256_1031419741	3300015372	Arabidopsis Rhizosphere	VEIDLRHLAVDLTRTTAMLLIAGLLILVLLPAALAANGR*
Ga0132257_1033679361	3300015373	Arabidopsis Rhizosphere	VDTDLRSLAVVMTRTVVMLLIATLLILVLLPAALAANGA*
Ga0132255_1013571052	3300015374	Arabidopsis Rhizosphere	VEIDLRNLAVDLTRTTAMLLIAGLLILVLLPAALAANGR*
Ga0136617_107012492	3300017789	Polar Desert Sand	VVWRLKSVETDPRSLAAVLTRTAAMLLIAALLILVLLPAVLAASSR
Ga0163161_114536442	3300017792	Switchgrass Rhizosphere	VEIDIRNLAVDLTRTTAMLLIAGLLILVLLPAALAANGR
Ga0184604_103149261	3300018000	Groundwater Sediment	EPRSLAAVVTRTAAMLLVAVLLILVLLPAALAASSR
Ga0184608_101615102	3300018028	Groundwater Sediment	VEIDSRSLAAVLTRTAAMLLLAVLLILVLLPAVLAASGR
Ga0184621_100914452	3300018054	Groundwater Sediment	VETDPRSLAAVLTRTAAMLLLAVLLILVLLPAALAASSR
Ga0184617_11614342	3300018066	Groundwater Sediment	VETDQRSWTAVLTRTAAMLLIASLLILVLLPAAWAASSR
Ga0190265_101077854	3300018422	Soil	LAVETDTRNLAVVLTRTAAMLLLAGILILVLLPEVLVASSR
Ga0190275_124488702	3300018432	Soil	LAVETDIRNLAVVLTRTAAMLLLAGLLILVLLPAALAASGR
Ga0066667_120590721	3300018433	Grasslands Soil	VETDPRSLTAVLTRTAAMLLLAVLLILVLLPAALAASSR
Ga0190269_106037182	3300018465	Soil	LAVKADLRSLAVVLTRTAAMLLLAALLILVLLPAALAASAR
Ga0190268_105091011	3300018466	Soil	MGVETDIRTLAVVLTRTAAMLLLAGLLILVLLPAALAASAR
Ga0190270_110510182	3300018469	Soil	LAVETDIRNLAVVLTRTAAMLLLAGLLILVLLPAALAASAR
Ga0190270_111429222	3300018469	Soil	VEIEPRSLAAVLTRTAAMLLIAVLLILVLLPAVLAASNR
Ga0190273_115813592	3300018920	Soil	VETDQRSWTAVLTRTAAMLLIASLLILVLLPAALAASGR
Ga0173482_106114722	3300019361	Soil	VEIDLRSLVVDMTRTTAMLLIAGLLILVLLPAALAANGR
Ga0190264_117524461	3300019377	Soil	KPVEADQRSWTAVVTRTLAMLFVASLLILVLLPAALAASGR
Ga0190267_101068881	3300019767	Soil	LAVETDIRHLAVVLTRTAAMLLLAGLLILVLLPAALAASAR
Ga0193747_10205382	3300019885	Soil	MSRLRAVETDPRSLAAVLTRTAAMLLIAVLLILVLLPAALAANSR
Ga0193729_10520914	3300019887	Soil	MAVGTDLVGLAAVTTRTIAMLLLAILLILVLLPAALAASAT
Ga0193718_10468031	3300019999	Soil	VGTDFRNLAVVLTRTTAMLLLAVLLILVILPAALAASGR
Ga0196964_105151612	3300020202	Soil	MGGVRRLYGVETDFRSLAVVLTRTTAMLLLAGLLILVLMPAVLAASSR
Ga0210362_12824671	3300021329	Estuarine	DPRSLAAVVTRTAAMLLLAVLLILVLLPAALAASSR
Ga0210334_104131702	3300021859	Estuarine	VEIDPRSLAAVVTRTAAMLLLAVLLILVLLPAALAASSR
Ga0247693_10135322	3300024181	Soil	VDTDLRSLAVVMTRTVVMLLIATLLILVLLPAALAANGA
Ga0209109_102608471	3300025160	Soil	VDINFRSLAVVLTRTAAMLFIAVLLILVLLPAALAASGR
Ga0207645_100772243	3300025907	Miscanthus Rhizosphere	MSSRLRAVEIDVRSLAAVLTRTAAMLLIAVLLILVLLPAALAASSR
Ga0207707_101209163	3300025912	Corn Rhizosphere	VEIDIRNLAVDLTRTTAMLLIAGLLILVLLPAALAASSR
Ga0207660_10000002769	3300025917	Corn Rhizosphere	VEIDFRSLAVVMTRTSAMLLFAALLILVLLPAALAANSR
Ga0207660_104850521	3300025917	Corn Rhizosphere	AQHKSRERRLRAVEIDLRNLAVVLTRTTAMLLIAGLLILVLLPAALAANGR
Ga0207660_107208522	3300025917	Corn Rhizosphere	VEIDLRSFVVDMTRTTAMLLIAGLLILVLLPAALAANGR
Ga0207652_118247612	3300025921	Corn Rhizosphere	PARRPRLRAVEIDIRNLAVDLTRTTAMLLIAGLLILVLLPAALAANGR
Ga0207646_100162992	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	VEIDVRSLATVMTRTAAMLLFAGLLILVLLPAAVAANAR
Ga0207646_112916812	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	VEIDIRSLAAVLTRTAAMLLIAVLLILVLLPAALAASSR
Ga0207681_109322912	3300025923	Switchgrass Rhizosphere	VEIDVRSLAAVLTRTAAMLLIAVLLILVLLPAALAANGR
Ga0207687_101383762	3300025927	Miscanthus Rhizosphere	MPSRLRAVEIDVRSLAAVLTRTAAMLLIAVLLILVL
Ga0207706_105971472	3300025933	Corn Rhizosphere	MPSRLRAVEIDIRSLAAVLTRTAAMLLIAVLLILVLLPAALAASSR
Ga0207686_106279863	3300025934	Miscanthus Rhizosphere	VEIDLRNLAVVLTRTTAMLLIAGLLILVLLPAALAANGR
Ga0207651_119794882	3300025960	Switchgrass Rhizosphere	VEIDVRSLAAVLTRTAAMLLIAALLILVLLPAALAANGR
Ga0207640_105403833	3300025981	Corn Rhizosphere	LRAVEIDLRSLVVDMTRTTAMLLIAGLLILVLLPAALAANGR
Ga0207678_109379711	3300026067	Corn Rhizosphere	DLRSLVVDMTRTTAMLLIAGLLILVLLPAALAANGR
Ga0207674_116299902	3300026116	Corn Rhizosphere	MDFRQLAVVMTRTAAMLLIAVLLILVLLPAALAANGT
Ga0209974_100876572	3300027876	Arabidopsis Thaliana Rhizosphere	VETDQRTWAAVLTRTLAMLFVASLLILVLLPAALAANGR
Ga0209974_102704801	3300027876	Arabidopsis Thaliana Rhizosphere	VETERRSWVAVLTRTATMLLIAAFLILVLLPAALAASVR
Ga0209974_104070802	3300027876	Arabidopsis Thaliana Rhizosphere	MAVETNLRSLAVVLTRTTAMLLLAGLLILVLLPAALAASGQ
Ga0307305_102780061	3300028807	Soil	RLRAVETDPRSLAAVLTRTAAMLLLAVLLILVLLPAALAASSR
Ga0307302_100131322	3300028814	Soil	VETDVRGLATALARTAAMLLLAGVTILVFLPAVLAANSR
Ga0307310_100383672	3300028824	Soil	VEIDPRGLAAVVTRTAAMLALAVLLILVLLPAALAASAR
Ga0307312_110784592	3300028828	Soil	MSRLRAVETDPRSLAAVLTRTAAMLLIAVLLILVLLPAALAASSR
Ga0307277_102763642	3300028881	Soil	VETDPRSLAAVLTRTAAMLLIAVLLILVLLPAALAASSR
Ga0307308_103528302	3300028884	Soil	VETDPRSLAAVLTRTAAMLLIAVLLILVLLPAALAANSR
Ga0307304_100456113	3300028885	Soil	VEIDVRSLAAVLTRTAAMLLIAVLLILVLLPAALAASSR
Ga0307304_105468411	3300028885	Soil	MSRQRAVDQDLRPLAVVMTRTAAMLLLAVLLILVLLPAALAASGN
Ga0119857_10038862	3300029304	Anaerobic Bioreactor	MARALRLKAVDTNLRSLAVAMTRTAAMLLIAVLLILVLLPAALAASGG
Ga0247826_101951302	3300030336	Soil	MAVETDIRNLAVVLTRTAAMLLLAGLLILVLLPAVLAASSR
Ga0299913_102516733	3300031229	Soil	LAVETDIRNLAVVLTRTAAMLLLAGILILVLLPEVLVASSR
Ga0310813_114423232	3300031716	Soil	VEIDFRSLAVVLTRTAAMLLIAVLLILVLLPAALAASSR
Ga0307416_1000855865	3300032002	Rhizosphere	RLLAVETDNRNLAVVLTRTAAMLLLAGLLILVLLPAALAASAG
Ga0307416_1030112322	3300032002	Rhizosphere	VETDQRSWAAVLTRTAAMLLIASLLILVLLPAALA
Ga0307472_1020951732	3300032205	Hardwood Forest Soil	ESAQHPAPRSRLRAVEIDIRNLAVDLTRTTAMLLIAGLLILVLLPAALAANGR
Ga0335082_101088952	3300032782	Soil	MDPRGFAVAVTRTLAMLLLASLLILVLLPAALAANGT
Ga0335082_110607541	3300032782	Soil	VGTDLRSLAVVVTRTVAMLLIATLLILVLLPAALAANGT
Ga0335084_102412922	3300033004	Soil	MAVGTDLRSLAVVVTRTVAMLLIATLLILVLLPAALAANGA
Ga0370484_0054421_98_217	3300034125	Untreated Peat Soil	VETDFRTLAVVLTRTTAMLLLAVLLILVILPAALAASGR

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.56
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.56
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F041156

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign