


| Basic Information | |
|---|---|
| Family ID | F035771 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 171 |
| Average Sequence Length | 40 residues |
| Representative Sequence | GNVEKSRQRRSRHFAVLTYSMYAPRVKMAAALLDGLF |
| Number of Associated Samples | 66 |
| Number of Associated Scaffolds | 171 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 19.39 % |
| % of genes near scaffold ends (potentially truncated) | 77.78 % |
| % of genes from short scaffolds (< 2000 bps) | 80.12 % |
| Associated GOLD sequencing projects | 55 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (85.965 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface (25.731 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.333 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) (32.164 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.31% β-sheet: 0.00% Coil/Unstructured: 47.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 171 Family Scaffolds |
|---|---|---|
| PF02627 | CMD | 1.75 |
| PF02554 | CstA | 1.75 |
| PF01925 | TauE | 1.17 |
| PF00989 | PAS | 1.17 |
| PF00571 | CBS | 1.17 |
| PF00174 | Oxidored_molyb | 1.17 |
| PF00805 | Pentapeptide | 1.17 |
| PF09656 | PGPGW | 1.17 |
| PF00462 | Glutaredoxin | 1.17 |
| PF00072 | Response_reg | 1.17 |
| PF00117 | GATase | 1.17 |
| PF08338 | DUF1731 | 1.17 |
| PF01416 | PseudoU_synth_1 | 1.17 |
| PF01059 | Oxidored_q5_N | 0.58 |
| PF05139 | Erythro_esteras | 0.58 |
| PF04343 | DUF488 | 0.58 |
| PF00549 | Ligase_CoA | 0.58 |
| PF07704 | PSK_trans_fac | 0.58 |
| PF01741 | MscL | 0.58 |
| PF16658 | RF3_C | 0.58 |
| PF08502 | LeuA_dimer | 0.58 |
| PF00595 | PDZ | 0.58 |
| PF02636 | Methyltransf_28 | 0.58 |
| PF01740 | STAS | 0.58 |
| PF01230 | HIT | 0.58 |
| PF03331 | LpxC | 0.58 |
| PF03477 | ATP-cone | 0.58 |
| PF03190 | Thioredox_DsbH | 0.58 |
| PF02321 | OEP | 0.58 |
| PF00691 | OmpA | 0.58 |
| PF13487 | HD_5 | 0.58 |
| PF13437 | HlyD_3 | 0.58 |
| PF00171 | Aldedh | 0.58 |
| PF13378 | MR_MLE_C | 0.58 |
| PF02597 | ThiS | 0.58 |
| PF02739 | 5_3_exonuc_N | 0.58 |
| PF03186 | CobD_Cbib | 0.58 |
| PF13411 | MerR_1 | 0.58 |
| PF05425 | CopD | 0.58 |
| PF16798 | DUF5069 | 0.58 |
| PF01152 | Bac_globin | 0.58 |
| PF02926 | THUMP | 0.58 |
| PF06325 | PrmA | 0.58 |
| PF05866 | RusA | 0.58 |
| PF04055 | Radical_SAM | 0.58 |
| PF11871 | DUF3391 | 0.58 |
| PF05015 | HigB-like_toxin | 0.58 |
| PF11799 | IMS_C | 0.58 |
| PF02142 | MGS | 0.58 |
| PF01061 | ABC2_membrane | 0.58 |
| PF03796 | DnaB_C | 0.58 |
| PF14793 | DUF4478 | 0.58 |
| PF02776 | TPP_enzyme_N | 0.58 |
| PF00437 | T2SSE | 0.58 |
| PF01252 | Peptidase_A8 | 0.58 |
| PF12838 | Fer4_7 | 0.58 |
| PF02746 | MR_MLE_N | 0.58 |
| PF13531 | SBP_bac_11 | 0.58 |
| PF04116 | FA_hydroxylase | 0.58 |
| PF02569 | Pantoate_ligase | 0.58 |
| PF01564 | Spermine_synth | 0.58 |
| PF09383 | NIL | 0.58 |
| PF05170 | AsmA | 0.58 |
| PF02527 | GidB | 0.58 |
| PF00180 | Iso_dh | 0.58 |
| PF00749 | tRNA-synt_1c | 0.58 |
| PF02277 | DBI_PRT | 0.58 |
| PF00672 | HAMP | 0.58 |
| PF13614 | AAA_31 | 0.58 |
| PF01381 | HTH_3 | 0.58 |
| PF04079 | SMC_ScpB | 0.58 |
| PF00224 | PK | 0.58 |
| PF01878 | EVE | 0.58 |
| PF07690 | MFS_1 | 0.58 |
| PF00346 | Complex1_49kDa | 0.58 |
| PF08447 | PAS_3 | 0.58 |
| PF04185 | Phosphoesterase | 0.58 |
| PF12118 | SprA-related | 0.58 |
| PF00581 | Rhodanese | 0.58 |
| PF05016 | ParE_toxin | 0.58 |
| PF02654 | CobS | 0.58 |
| PF02661 | Fic | 0.58 |
| PF05940 | NnrS | 0.58 |
| PF13551 | HTH_29 | 0.58 |
| PF04468 | PSP1 | 0.58 |
| PF11199 | DUF2891 | 0.58 |
| PF01257 | 2Fe-2S_thioredx | 0.58 |
| PF13710 | ACT_5 | 0.58 |
| PF01791 | DeoC | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 171 Family Scaffolds |
|---|---|---|---|
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 1.75 |
| COG1966 | Carbon starvation protein CstA (peptide/pyruvate transporter) | Energy production and conversion [C] | 1.75 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 1.75 |
| COG0101 | tRNA U38,U39,U40 pseudouridine synthase TruA | Translation, ribosomal structure and biogenesis [J] | 1.17 |
| COG0597 | Lipoprotein signal peptidase | Cell wall/membrane/envelope biogenesis [M] | 1.17 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 1.17 |
| COG1090 | NAD dependent epimerase/dehydratase family enzyme | General function prediction only [R] | 1.17 |
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 1.17 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.17 |
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 1.17 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 1.17 |
| COG4948 | L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamily | Cell wall/membrane/envelope biogenesis [M] | 1.17 |
| COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.58 |
| COG0045 | Succinyl-CoA synthetase, beta subunit | Energy production and conversion [C] | 0.58 |
| COG0074 | Succinyl-CoA synthetase, alpha subunit | Energy production and conversion [C] | 0.58 |
| COG0119 | Isopropylmalate/homocitrate/citramalate synthases | Amino acid transport and metabolism [E] | 0.58 |
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 0.58 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.58 |
| COG0357 | 16S rRNA G527 N7-methylase RsmG (former glucose-inhibited division protein B) | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| COG0368 | Cobalamin synthase CobS (adenosylcobinamide-GDP ribazoletransferase) | Coenzyme transport and metabolism [H] | 0.58 |
| COG0414 | Panthothenate synthetase | Coenzyme transport and metabolism [H] | 0.58 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.58 |
| COG0649 | NADH:ubiquinone oxidoreductase 49 kD subunit (chain D) | Energy production and conversion [C] | 0.58 |
| COG0774 | UDP-3-O-acyl-N-acetylglucosamine deacetylase | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.58 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.58 |
| COG1270 | Cobalamin biosynthesis protein CobD/CbiB | Coenzyme transport and metabolism [H] | 0.58 |
| COG1276 | Putative copper export protein | Inorganic ion transport and metabolism [P] | 0.58 |
| COG1331 | Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains | General function prediction only [R] | 0.58 |
| COG1386 | Chromosome segregation and condensation protein ScpB | Transcription [K] | 0.58 |
| COG1565 | SAM-dependent methyltransferase, MidA family | General function prediction only [R] | 0.58 |
| COG1673 | Predicted RNA-binding protein, contains PUA-like EVE domain | General function prediction only [R] | 0.58 |
| COG1774 | Cell fate regulator YaaT, PSP1 superfamily (controls sporulation, competence, biofilm development) | Signal transduction mechanisms [T] | 0.58 |
| COG1905 | NADH:ubiquinone oxidoreductase 24 kD subunit (chain E) | Energy production and conversion [C] | 0.58 |
| COG1970 | Large-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
| COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 0.58 |
| COG2038 | NaMN:DMB phosphoribosyltransferase | Coenzyme transport and metabolism [H] | 0.58 |
| COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 0.58 |
| COG2264 | Ribosomal protein L11 methylase PrmA | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| COG2312 | Erythromycin esterase homolog | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.58 |
| COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 0.58 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| COG2947 | Predicted RNA-binding protein, contains EVE domain | General function prediction only [R] | 0.58 |
| COG2982 | Uncharacterized conserved protein AsmA involved in outer membrane biogenesis | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
| COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 0.58 |
| COG3189 | Uncharacterized conserved protein YeaO, DUF488 family | Function unknown [S] | 0.58 |
| COG3213 | Nitric oxide response protein NnrS | Signal transduction mechanisms [T] | 0.58 |
| COG3261 | Ni,Fe-hydrogenase III large subunit | Energy production and conversion [C] | 0.58 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
| COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.58 |
| COG3897 | Protein N-terminal and lysine N-methylase, NNT1/EFM7 family | Posttranslational modification, protein turnover, chaperones [O] | 0.58 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.58 |
| COG4423 | Uncharacterized conserved protein | Function unknown [S] | 0.58 |
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.13 % |
| Unclassified | root | N/A | 12.87 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000124|BS_KBA_SWE12_21mDRAFT_c10014559 | Not Available | 2483 | Open in IMG/M |
| 3300000241|BS_KBA_SWE21_205mDRAFT_10024846 | All Organisms → cellular organisms → Bacteria | 1586 | Open in IMG/M |
| 3300003702|PicMicro_10028699 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii | 3787 | Open in IMG/M |
| 3300003702|PicMicro_10029882 | All Organisms → cellular organisms → Bacteria | 9365 | Open in IMG/M |
| 3300003885|Ga0063294_10006264 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii | 8613 | Open in IMG/M |
| 3300003885|Ga0063294_10312176 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300003885|Ga0063294_10352529 | Not Available | 901 | Open in IMG/M |
| 3300003885|Ga0063294_10769902 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 564 | Open in IMG/M |
| 3300003886|Ga0063293_10229824 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1362 | Open in IMG/M |
| 3300004061|Ga0055487_10089127 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300004075|Ga0055519_10105123 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina | 632 | Open in IMG/M |
| 3300005588|Ga0070728_10444411 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 683 | Open in IMG/M |
| 3300005590|Ga0070727_10055061 | All Organisms → cellular organisms → Bacteria | 2380 | Open in IMG/M |
| 3300005590|Ga0070727_10355163 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 816 | Open in IMG/M |
| 3300005601|Ga0070722_10084044 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
| 3300005601|Ga0070722_10099433 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium CG_4_9_14_3_um_filter_51_5 | 1113 | Open in IMG/M |
| 3300005601|Ga0070722_10214443 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300005601|Ga0070722_10344998 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 645 | Open in IMG/M |
| 3300005601|Ga0070722_10413492 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales | 595 | Open in IMG/M |
| 3300005601|Ga0070722_10486035 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 553 | Open in IMG/M |
| 3300005612|Ga0070723_10110265 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300005612|Ga0070723_10146697 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300005828|Ga0074475_10017902 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 632 | Open in IMG/M |
| 3300005828|Ga0074475_10149212 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
| 3300005920|Ga0070725_10100645 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales | 1246 | Open in IMG/M |
| 3300005920|Ga0070725_10465805 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 567 | Open in IMG/M |
| 3300006467|Ga0099972_11459495 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → unclassified Planctomycetales → Planctomycetales bacterium 12-60-4 | 501 | Open in IMG/M |
| 3300006467|Ga0099972_13563584 | Not Available | 719 | Open in IMG/M |
| 3300006468|Ga0082251_10114850 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1068 | Open in IMG/M |
| 3300006792|Ga0075530_1107476 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira | 908 | Open in IMG/M |
| 3300006792|Ga0075530_1190324 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 643 | Open in IMG/M |
| 3300006792|Ga0075530_1224164 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → unclassified Nitrospirales → Nitrospirales bacterium | 585 | Open in IMG/M |
| 3300009030|Ga0114950_10003030 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 12967 | Open in IMG/M |
| 3300009030|Ga0114950_10033393 | All Organisms → cellular organisms → Bacteria | 4042 | Open in IMG/M |
| 3300009030|Ga0114950_10417156 | All Organisms → cellular organisms → Bacteria → PVC group → Chlamydiae → Chlamydiia → Parachlamydiales → unclassified Parachlamydiales → Parachlamydiales bacterium | 1077 | Open in IMG/M |
| 3300009030|Ga0114950_11123769 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 613 | Open in IMG/M |
| 3300009030|Ga0114950_11428663 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 536 | Open in IMG/M |
| 3300009095|Ga0079224_101677512 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 902 | Open in IMG/M |
| 3300009102|Ga0114948_10060564 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 2381 | Open in IMG/M |
| 3300009102|Ga0114948_10063673 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 2333 | Open in IMG/M |
| 3300009102|Ga0114948_10074311 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → unclassified Nitrospirales → Nitrospirales bacterium | 2188 | Open in IMG/M |
| 3300009102|Ga0114948_10103182 | All Organisms → cellular organisms → Bacteria | 1908 | Open in IMG/M |
| 3300009102|Ga0114948_10135158 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae | 1698 | Open in IMG/M |
| 3300009102|Ga0114948_10204337 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae | 1415 | Open in IMG/M |
| 3300009102|Ga0114948_10279907 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 1224 | Open in IMG/M |
| 3300009102|Ga0114948_10337556 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300009102|Ga0114948_10462738 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 963 | Open in IMG/M |
| 3300009102|Ga0114948_10619291 | Not Available | 834 | Open in IMG/M |
| 3300009102|Ga0114948_10708582 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 780 | Open in IMG/M |
| 3300009102|Ga0114948_10709941 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 779 | Open in IMG/M |
| 3300009102|Ga0114948_10934294 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 679 | Open in IMG/M |
| 3300009102|Ga0114948_10981463 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 663 | Open in IMG/M |
| 3300009139|Ga0114949_10147071 | All Organisms → cellular organisms → Bacteria | 1846 | Open in IMG/M |
| 3300009139|Ga0114949_10551621 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 923 | Open in IMG/M |
| 3300009139|Ga0114949_11664982 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 510 | Open in IMG/M |
| 3300009139|Ga0114949_11673205 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 509 | Open in IMG/M |
| 3300009504|Ga0114946_10065743 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 2056 | Open in IMG/M |
| 3300009504|Ga0114946_10362436 | Not Available | 755 | Open in IMG/M |
| 3300009504|Ga0114946_10515093 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales | 611 | Open in IMG/M |
| 3300009504|Ga0114946_10645740 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 533 | Open in IMG/M |
| 3300009515|Ga0129286_10104428 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 854 | Open in IMG/M |
| 3300009515|Ga0129286_10161467 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300009515|Ga0129286_10315002 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 569 | Open in IMG/M |
| 3300009702|Ga0114931_10355449 | Not Available | 996 | Open in IMG/M |
| 3300010350|Ga0116244_10719689 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 645 | Open in IMG/M |
| 3300010350|Ga0116244_10936465 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 553 | Open in IMG/M |
| 3300010392|Ga0118731_100401078 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 635 | Open in IMG/M |
| 3300010392|Ga0118731_106334293 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1036 | Open in IMG/M |
| 3300010392|Ga0118731_106959996 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 1248 | Open in IMG/M |
| 3300010392|Ga0118731_107163605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2429 | Open in IMG/M |
| 3300010392|Ga0118731_113501632 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales | 540 | Open in IMG/M |
| 3300010392|Ga0118731_114332999 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 511 | Open in IMG/M |
| 3300010430|Ga0118733_100361222 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → unclassified Nitrospirales → Nitrospirales bacterium | 2876 | Open in IMG/M |
| 3300010430|Ga0118733_101198740 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 1516 | Open in IMG/M |
| 3300010430|Ga0118733_101678830 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
| 3300010430|Ga0118733_103185066 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 896 | Open in IMG/M |
| 3300010430|Ga0118733_105685453 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 655 | Open in IMG/M |
| 3300010967|Ga0139247_1142602 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera → Ephemeroptera → Furcatergalia → Scapphodonta → Ephemeridae → Ephemera → Ephemera danica | 645 | Open in IMG/M |
| 3300010968|Ga0139250_1015313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_60_19 | 1460 | Open in IMG/M |
| 3300010968|Ga0139250_1055480 | Not Available | 859 | Open in IMG/M |
| 3300010969|Ga0139246_1040778 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
| 3300010969|Ga0139246_1069828 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 773 | Open in IMG/M |
| 3300011112|Ga0114947_10011731 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 4094 | Open in IMG/M |
| 3300011112|Ga0114947_10247796 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 1194 | Open in IMG/M |
| 3300011112|Ga0114947_10842888 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 673 | Open in IMG/M |
| 3300011112|Ga0114947_10857286 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 668 | Open in IMG/M |
| 3300011112|Ga0114947_11360307 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 534 | Open in IMG/M |
| 3300011112|Ga0114947_11378097 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 531 | Open in IMG/M |
| 3300011112|Ga0114947_11387174 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae | 529 | Open in IMG/M |
| 3300011112|Ga0114947_11466653 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300020230|Ga0212167_1137256 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii | 2474 | Open in IMG/M |
| 3300020231|Ga0212168_1232658 | All Organisms → cellular organisms → Bacteria | 7209 | Open in IMG/M |
| 3300020231|Ga0212168_1269415 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 1434 | Open in IMG/M |
| 3300020231|Ga0212168_1306684 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 2016 | Open in IMG/M |
| 3300020231|Ga0212168_1411848 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
| 3300020231|Ga0212168_1414806 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 1370 | Open in IMG/M |
| 3300020232|Ga0212226_148356 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1885 | Open in IMG/M |
| 3300020232|Ga0212226_175590 | All Organisms → cellular organisms → Bacteria | 2045 | Open in IMG/M |
| 3300020234|Ga0212227_1309976 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 2033 | Open in IMG/M |
| 3300020234|Ga0212227_1380329 | All Organisms → cellular organisms → Bacteria | 2820 | Open in IMG/M |
| 3300020235|Ga0212228_1155577 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 10147 | Open in IMG/M |
| 3300020235|Ga0212228_1453059 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 4154 | Open in IMG/M |
| 3300021316|Ga0210351_1297596 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. SG8_28 | 572 | Open in IMG/M |
| 3300022201|Ga0224503_10172926 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300022201|Ga0224503_10244505 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 589 | Open in IMG/M |
| 3300022202|Ga0224498_10056831 | Not Available | 1107 | Open in IMG/M |
| 3300022202|Ga0224498_10073536 | Not Available | 975 | Open in IMG/M |
| 3300022202|Ga0224498_10086035 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300022202|Ga0224498_10090856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 878 | Open in IMG/M |
| 3300022202|Ga0224498_10156068 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300022202|Ga0224498_10161388 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300022202|Ga0224498_10176888 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 629 | Open in IMG/M |
| 3300022202|Ga0224498_10223778 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300022204|Ga0224496_10388876 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 563 | Open in IMG/M |
| 3300022206|Ga0224499_10017507 | All Organisms → cellular organisms → Bacteria | 2190 | Open in IMG/M |
| 3300022206|Ga0224499_10023657 | All Organisms → cellular organisms → Bacteria | 1926 | Open in IMG/M |
| 3300022206|Ga0224499_10024319 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 1903 | Open in IMG/M |
| 3300022206|Ga0224499_10308869 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 534 | Open in IMG/M |
| 3300022220|Ga0224513_10135850 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 949 | Open in IMG/M |
| 3300022220|Ga0224513_10299829 | Not Available | 640 | Open in IMG/M |
| 3300022220|Ga0224513_10367509 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300022223|Ga0224501_10385774 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 696 | Open in IMG/M |
| 3300022223|Ga0224501_10528815 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 561 | Open in IMG/M |
| 3300022226|Ga0224512_10325336 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → unclassified Nitrospirales → Nitrospirales bacterium | 767 | Open in IMG/M |
| 3300022306|Ga0224509_10281177 | Not Available | 603 | Open in IMG/M |
| 3300022396|Ga0210364_1179557 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 503 | Open in IMG/M |
| 3300022413|Ga0224508_10140778 | All Organisms → cellular organisms → Bacteria | 1596 | Open in IMG/M |
| 3300022413|Ga0224508_10182287 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Candidatus Nitrospira nitrosa | 1376 | Open in IMG/M |
| 3300022413|Ga0224508_10507911 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae | 751 | Open in IMG/M |
| 3300024058|Ga0209997_10061591 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium ADurb.Bin412 | 1684 | Open in IMG/M |
| 3300024060|Ga0209987_10268875 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 957 | Open in IMG/M |
| 3300024060|Ga0209987_10596815 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 579 | Open in IMG/M |
| 3300024431|Ga0209988_10013394 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 5314 | Open in IMG/M |
| 3300024431|Ga0209988_10137995 | All Organisms → cellular organisms → Bacteria | 1471 | Open in IMG/M |
| 3300024431|Ga0209988_10609001 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 569 | Open in IMG/M |
| 3300024516|Ga0209980_10001836 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 11652 | Open in IMG/M |
| 3300024516|Ga0209980_10002912 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 9235 | Open in IMG/M |
| 3300024516|Ga0209980_10042017 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 2312 | Open in IMG/M |
| 3300024516|Ga0209980_10068052 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1769 | Open in IMG/M |
| 3300024516|Ga0209980_10175546 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1001 | Open in IMG/M |
| 3300024516|Ga0209980_10184875 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300024516|Ga0209980_10367014 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 626 | Open in IMG/M |
| (restricted) 3300024521|Ga0255056_10332867 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| (restricted) 3300024521|Ga0255056_10413254 | Not Available | 623 | Open in IMG/M |
| 3300025835|Ga0210039_1360966 | Not Available | 517 | Open in IMG/M |
| 3300025883|Ga0209456_10053898 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 1808 | Open in IMG/M |
| 3300025883|Ga0209456_10142971 | Not Available | 1040 | Open in IMG/M |
| 3300025895|Ga0209567_10620081 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 524 | Open in IMG/M |
| 3300027758|Ga0209379_10140471 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → unclassified Nitrospirales → Nitrospirales bacterium | 853 | Open in IMG/M |
| 3300027820|Ga0209578_10367124 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 660 | Open in IMG/M |
| 3300027845|Ga0209271_10188991 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 840 | Open in IMG/M |
| 3300027978|Ga0209165_10134362 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 863 | Open in IMG/M |
| 3300027978|Ga0209165_10146607 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300028399|Ga0256830_1020677 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 3049 | Open in IMG/M |
| 3300028399|Ga0256830_1100884 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300028420|Ga0210366_10181862 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 790 | Open in IMG/M |
| 3300028420|Ga0210366_10212626 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales | 741 | Open in IMG/M |
| 3300028420|Ga0210366_10217212 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira | 734 | Open in IMG/M |
| 3300028420|Ga0210366_10250145 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 693 | Open in IMG/M |
| 3300028598|Ga0265306_10082870 | Not Available | 1632 | Open in IMG/M |
| 3300028599|Ga0265309_10797308 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300028599|Ga0265309_10905985 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300028600|Ga0265303_10414733 | Not Available | 1071 | Open in IMG/M |
| 3300029948|Ga0119873_1028742 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 754 | Open in IMG/M |
| 3300032259|Ga0316190_10418597 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 25.73% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 15.20% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 13.45% |
| Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment | 8.19% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 5.26% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.51% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 2.34% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.34% |
| Hydrothermal Chimney Microbial Mat | Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Chimney Microbial Mat | 2.92% |
| Hydrothermal Vents | Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Hydrothermal Vents | 2.92% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 2.92% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 1.75% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.75% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 1.17% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.17% |
| Marine | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine | 1.17% |
| Hydrothermal Vents | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents | 1.17% |
| Marine, Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Marine, Hydrothermal Vent Plume | 1.17% |
| Seawater | Environmental → Aquatic → Marine → Gulf → Unclassified → Seawater | 1.17% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.17% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 1.17% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.58% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.58% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil | 0.58% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000124 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21m | Environmental | Open in IMG/M |
| 3300000241 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBB sample SWE 21_20.5m | Environmental | Open in IMG/M |
| 3300003702 | Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Piccard2013-Plume - Microbial Assembly | Environmental | Open in IMG/M |
| 3300003885 | Black smoker hydrothermal vent sediment microbial communities from the Guaymas Basin, Mid-Atlantic Ridge, South Atlantic Ocean - Sample 1 | Environmental | Open in IMG/M |
| 3300003886 | Black smoker hydrothermal vent sediment microbial communities from the Guaymas Basin, Mid-Atlantic Ridge, South Atlantic Ocean - Sample 1 | Environmental | Open in IMG/M |
| 3300004061 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004075 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004113 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (version 2) | Environmental | Open in IMG/M |
| 3300005588 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1 | Environmental | Open in IMG/M |
| 3300005590 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 | Environmental | Open in IMG/M |
| 3300005601 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 | Environmental | Open in IMG/M |
| 3300005612 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 | Environmental | Open in IMG/M |
| 3300005828 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.182_BBI | Environmental | Open in IMG/M |
| 3300005920 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2 | Environmental | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300006468 | Deep-sea sediment bacterial and archaeal communities from Fram Strait - Combined Assembly of Gp0119454, Gp0119453, Gp0119452, Gp0119451 | Environmental | Open in IMG/M |
| 3300006792 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL1-D | Environmental | Open in IMG/M |
| 3300009030 | Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N075 metaG | Environmental | Open in IMG/M |
| 3300009095 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015 | Environmental | Open in IMG/M |
| 3300009102 | Deep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR04 metaG | Environmental | Open in IMG/M |
| 3300009139 | Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N074 metaG | Environmental | Open in IMG/M |
| 3300009504 | Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep Sediment | Environmental | Open in IMG/M |
| 3300009515 | Microbial community of beach aquifer sediment core from Cape Shores, Lewes, Delaware, USA - CF-2 | Environmental | Open in IMG/M |
| 3300009702 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV14_V59a metaG | Environmental | Open in IMG/M |
| 3300010350 | AD_HKSTca | Engineered | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300010967 | Microbial communities from the inside layer of the microbial mat covering an inactive hydrothermal chimney from the Kolumbo submarine volcano, Santorini, Greece - V16_c.in | Environmental | Open in IMG/M |
| 3300010968 | Microbial communities from the middle layer of the microbial mat covering an inactive hydrothermal chimney from the Kolumbo submarine volcano, Santorini, Greece - V16_c.mid | Environmental | Open in IMG/M |
| 3300010969 | Microbial communities from the outside layer of the microbial mat covering an inactive hydrothermal chimney from the Kolumbo submarine volcano, Santorini, Greece - V16_c.out | Environmental | Open in IMG/M |
| 3300011112 | Deep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR02 metaG | Environmental | Open in IMG/M |
| 3300020230 | Deep-sea sediment microbial communities from the Mariana Trench, Pacific Ocean - CR02 | Environmental | Open in IMG/M |
| 3300020231 | Deep-sea sediment microbial communities from the Mariana Trench, Pacific Ocean - CR04 | Environmental | Open in IMG/M |
| 3300020232 | Deep-sea sediment microbial communities from the Mariana Trench, Pacific Ocean - CR05 | Environmental | Open in IMG/M |
| 3300020234 | Deep-sea sediment microbial communities from the Kermadec Trench, Pacific Ocean - N074 | Environmental | Open in IMG/M |
| 3300020235 | Deep-sea sediment microbial communities from the Kermadec Trench, Pacific Ocean - N075 | Environmental | Open in IMG/M |
| 3300021316 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.485 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022201 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022202 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022204 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_8_1 | Environmental | Open in IMG/M |
| 3300022206 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022220 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022223 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_8_1 | Environmental | Open in IMG/M |
| 3300022226 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_13 | Environmental | Open in IMG/M |
| 3300022306 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022396 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.633 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022413 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300024058 | Deep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR04 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024060 | Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N074 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024431 | Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N075 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024516 | Deep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR02 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024521 (restricted) | Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_1 | Environmental | Open in IMG/M |
| 3300025835 | Groundwater microbial communities from aquifer - Crystal Geyser CG17_big_fil_post_rev_8/21/14_2.50 (SPAdes) | Environmental | Open in IMG/M |
| 3300025883 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300025895 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027758 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027820 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027845 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027978 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028399 | Hydrothermal vent microbial communities from Lau Basin, Pacific Ocean - 128-326 | Environmental | Open in IMG/M |
| 3300028420 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.641 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028598 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160420 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300028599 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160524 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300028600 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300029948 | Activated sludge microbial communities from Shatin wastewater treatment plant, Hong Kong - ST_Foam_2012.3 | Engineered | Open in IMG/M |
| 3300032259 | Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BS_KBA_SWE12_21mDRAFT_100145595 | 3300000124 | Marine | IHIGAVEKSRQRRSRHFSVLTYWKYAPRAKMAAALLDELF* |
| BS_KBA_SWE21_205mDRAFT_100248462 | 3300000241 | Marine | KERFLLGAVEKSRQRRSCQFSVLTYWKYALREKLTAALLDELF* |
| PicMicro_100286993 | 3300003702 | Marine, Hydrothermal Vent Plume | MIHGNVEKSRQRRFRPFAVLTYYEYAPRVKMAAALLDGLF* |
| PicMicro_100298823 | 3300003702 | Marine, Hydrothermal Vent Plume | MNIGKVEKCFQRRSHHFVVLTYSMYVPRVKMTAALLDELF* |
| Ga0063294_100062645 | 3300003885 | Hydrothermal Vents | MDQNNLTWNVEKSRQQRSRLFAVLTYSMYAPLVKKAAALLDGLF* |
| Ga0063294_103121761 | 3300003885 | Hydrothermal Vents | MMPPYGKVEKSRQRRSRHFAVLTYFMYAPRVKIAAVLLDGLF* |
| Ga0063294_103525293 | 3300003885 | Hydrothermal Vents | MLGISECSFGNVEKSRQRRSRQVAVLTYWEYAPRVKLTAALLDGL |
| Ga0063294_107699021 | 3300003885 | Hydrothermal Vents | MLKGNVEKSRQRRSRHFAVLTYYEYAPLVKMAAALLDELF* |
| Ga0063293_102298243 | 3300003886 | Hydrothermal Vents | MFEKTNGNVEKSRQRRSRHFAVLTYYEYAPHVKKAAALLDGLF* |
| Ga0055487_100891272 | 3300004061 | Natural And Restored Wetlands | GEFIQMAKGTVEKSRQRRSRYFSVLTYWKHPLRAKMAAALLNELF* |
| Ga0055519_101051232 | 3300004075 | Natural And Restored Wetlands | RDRNPYGNVEKIRQRRSRPFAVLTYCEYAPRLKMAAVLLDELF* |
| Ga0065183_107640811 | 3300004113 | Pelagic Marine | FHVCLEITPSLFQNGSVEKSRQRRSRQFSVLTYYQYAPRAKLAAALLDGLF* |
| Ga0070728_104444112 | 3300005588 | Marine Sediment | GSVEKSRQRRSRHFSVLTYGMYAPRAKMAAALLDGLF* |
| Ga0070727_100550611 | 3300005590 | Marine Sediment | MFGNVEKSHQRRSHNFVVLTYWKYAPRVKIAAALLDEFF |
| Ga0070727_103551631 | 3300005590 | Marine Sediment | NVEKSRQQRSRHFAVLTYWEYAPRVKLAAALLDGLF* |
| Ga0070722_100840441 | 3300005601 | Marine Sediment | VEKSRQRRSRPFAVLTYRVYAPRVKMAAALLGGLF* |
| Ga0070722_100994331 | 3300005601 | Marine Sediment | MDPRRQPSGMTELEEEGSVEKSRQRRSRHFSVLTYGMYAPRAKMAAALLDGLF* |
| Ga0070722_102144431 | 3300005601 | Marine Sediment | GNVEKSRQRRSRYFAVLTYFMYAPRVKMASALLDGLF* |
| Ga0070722_103449981 | 3300005601 | Marine Sediment | PHYGNVEKSRQRRSRHCAVLTYLMYAPRVKMAAALLDGLF* |
| Ga0070722_104134921 | 3300005601 | Marine Sediment | GNVEKSRQRRSRHFAVLTYFMYAPRVKIAAALLDGLF* |
| Ga0070722_104860352 | 3300005601 | Marine Sediment | GNVEKNRQRRSRHFAVLTYRVYAPLAKVAAALLGELF* |
| Ga0070723_101102652 | 3300005612 | Marine Sediment | MRGVKGNVEKSRQRRSRYFAVLTYFMYAPRVKMASALLDGLF* |
| Ga0070723_101466971 | 3300005612 | Marine Sediment | EKSRQQRSRHFAVLTYWEYAPRVKLAAALLDGLF* |
| Ga0074475_100179023 | 3300005828 | Sediment (Intertidal) | GAVEKSRQRRSHQFSVLTYWKYAPRAKLAAALLDERF* |
| Ga0074475_101492121 | 3300005828 | Sediment (Intertidal) | MQGAVEKSRQRRSHQFSVLTYWKYAPRAKMAAALLDELF* |
| Ga0070725_101006452 | 3300005920 | Marine Sediment | MTELEEEGSVEKSRQRRSRHFSVLTYGMYAPRAKMAAALLDGLF* |
| Ga0070725_104658051 | 3300005920 | Marine Sediment | GNVEKSRQRRSRHVAVLTYKVYAPRVKIAAALLDELF* |
| Ga0099972_114594952 | 3300006467 | Marine | MKPANQGNVEKIHQRRSRHFVVLTYWKYAPRVKIAAALLD |
| Ga0099972_119531611 | 3300006467 | Marine | ILSMDLEGVNRGNVEKSRQRRSRHVAVLTYCEYAPRVNIAAALLDGLF* |
| Ga0099972_135635841 | 3300006467 | Marine | VTNNGNVEKSHQQRSRHFVVLTYWKYAPRVQIAAALLDDF |
| Ga0082251_101148502 | 3300006468 | Sediment | MFEKTNGTVEKSRQRRSRPFAVLTYSMYAPRVKMAAALL |
| Ga0075530_11074762 | 3300006792 | Arctic Peat Soil | GAVEKSRQRRSRHFSVLTYWKYALRAKMTAALLDELF* |
| Ga0075530_11903242 | 3300006792 | Arctic Peat Soil | EKSRQRRSRHFSVLTYWKYALRAKMTAALLDELF* |
| Ga0075530_12241642 | 3300006792 | Arctic Peat Soil | AGSTTGAVEKSRQRRSRHFSVLTYRKYALRAKMTAALLDELF* |
| Ga0114950_1000303012 | 3300009030 | Deep Subsurface | EKSRQRRSRPFAVLTYYEYAPRVKRAAALLDGLF* |
| Ga0114950_100333931 | 3300009030 | Deep Subsurface | GNVEKSRQRRSRHFAVLTYSMYAPRVKMAAALLDELF* |
| Ga0114950_104171561 | 3300009030 | Deep Subsurface | RILRGNVEKSRQRRSRPFAVLTYYEYAPRVKRAAALLDELF* |
| Ga0114950_111237692 | 3300009030 | Deep Subsurface | GNVEKSRQRRSRHFAVLTYSMYAPLVKMAAALLDGLF* |
| Ga0114950_114286632 | 3300009030 | Deep Subsurface | GNVEKSRQRRSRPFAVLTYYEYAPRVKMAAALLDELF* |
| Ga0079224_1016775121 | 3300009095 | Agricultural Soil | ANGAVEKSRQRRSRHFSVLTYWKYALRAKMTAAFPSA* |
| Ga0114948_100605646 | 3300009102 | Deep Subsurface | GNVEKSRQRRSRPFAVLTYCEYAPLVKMAAALLDELF* |
| Ga0114948_100636733 | 3300009102 | Deep Subsurface | MKGNVEKSRQRRSRPFAVLTYWEYAPRVKTAAALLDELF* |
| Ga0114948_100743113 | 3300009102 | Deep Subsurface | GNVEKSRQRRSRPFAVLTYYEYAPRVKRAAALLDGLF* |
| Ga0114948_101031821 | 3300009102 | Deep Subsurface | IENGRQRRSPHFAVLTYSMHAPRVKIAVALLDGPF* |
| Ga0114948_101351581 | 3300009102 | Deep Subsurface | GNVEKSRQRRSRPFAVLTYYEYAPRVKMAAALLDGLF* |
| Ga0114948_102043373 | 3300009102 | Deep Subsurface | MSQALSRGGNVEKSRQRRSRPFAVLTYYEYAPRVKMAAALLD |
| Ga0114948_102799072 | 3300009102 | Deep Subsurface | VGNVEKNRQRRSRHFAVLTYWEYAPRAKMAAALLDGFPA |
| Ga0114948_103375562 | 3300009102 | Deep Subsurface | FFGLFQGNVEKSRQLCSRHFAVLTNSMYAPRVKIAAALLDELF* |
| Ga0114948_104627381 | 3300009102 | Deep Subsurface | GNVEKSRQRRSRHFAVLTYSLYAPRVKMAAALLDELF* |
| Ga0114948_106192911 | 3300009102 | Deep Subsurface | GHTLGNVEKSRQRRSCPFAVLTYYEYAPRVKSAAALLDGLF* |
| Ga0114948_107085821 | 3300009102 | Deep Subsurface | LRGNVEKSRQRRSRPFAVLTYYEYAPRVKKAAALLDGLF* |
| Ga0114948_107099412 | 3300009102 | Deep Subsurface | MNVGNVEKSRQRRSRHFAVLTYSMYAPRVKMAAALLDGLF* |
| Ga0114948_109342941 | 3300009102 | Deep Subsurface | GSSGNVEKSRQRRSRHFAVLAYSMYAPRVKMAAALLDELF* |
| Ga0114948_109814633 | 3300009102 | Deep Subsurface | NVEKSRQRRSRPFAVLTYYEYAPRVKRAAALLDGLF* |
| Ga0114949_101470711 | 3300009139 | Deep Subsurface | MTGMVDGNVEKSRQRRSRPFAVLTYYEYAPRVKRAAA |
| Ga0114949_105516213 | 3300009139 | Deep Subsurface | EKSRQRRSRPFAVLTYYEYAPRVKRAAALLDELF* |
| Ga0114949_116649821 | 3300009139 | Deep Subsurface | MAGNVEKSRQRRSRPFAVLTYYEYAPRVKRAAALL |
| Ga0114949_116732051 | 3300009139 | Deep Subsurface | RFCEKDASGNVEKSRQRRSRPFAVLTYYEYAPRVKMAAALLDGLF* |
| Ga0114946_100657431 | 3300009504 | Sediment | GSVEKSRQRRSRHFYVLTYSAYAPRVKTAAALLDRLF* |
| Ga0114946_103624361 | 3300009504 | Sediment | MFEAAVEGNGSVENSRQRRSRHFSVLTYSAYAPRVKTAAALLD |
| Ga0114946_105150931 | 3300009504 | Sediment | SVEKSRQRRSRHFSVLTYSAYAPRVKMAAALLDGLF* |
| Ga0114946_106457401 | 3300009504 | Sediment | MANISSGSVEKSRQRRSRHFSVLTYSAYAPRVKMAAALLD |
| Ga0129286_101044282 | 3300009515 | Sediment | EGNVEKSRQRRSRQFAVLTYYEYAPRVKMAAALLDGLF* |
| Ga0129286_101614671 | 3300009515 | Sediment | MMPPYGNVEKSRQRRSRHFAVLTYFMHAPRVKIATALLDGLF* |
| Ga0129286_103150022 | 3300009515 | Sediment | GNVEKSRQRRSRHFAVLTYSMYAPRVKMAAALLD* |
| Ga0114931_103554493 | 3300009702 | Deep Subsurface | MKKSSQGNVEKSRQRRSRPFAVLTYETYAPRVKTAAALLD |
| Ga0116244_107196892 | 3300010350 | Anaerobic Digestor Sludge | VEKSRQRRSRHFSVLTYWKYALRAKMTAALLDELF* |
| Ga0116244_109364651 | 3300010350 | Anaerobic Digestor Sludge | MSGAVEKGRQRRSRHSPMLTYWKYALRAKMTATLQDELF* |
| Ga0118731_1004010781 | 3300010392 | Marine | EKSRQRRSRHFAVLTYSMYAPRVKMAAALLDGLF* |
| Ga0118731_1063342931 | 3300010392 | Marine | GNVEKSRQRRSRHFAVLSYSMYAPRVKMAAAFLDGPF* |
| Ga0118731_1069599962 | 3300010392 | Marine | IGNVEKSRQRRSRHFAVLTYSMYAPRVKMAAALLDGLF* |
| Ga0118731_1071636053 | 3300010392 | Marine | EKSRQRRSRHFAVLTYSMYAPRVKMAAVLLDGLF* |
| Ga0118731_1135016322 | 3300010392 | Marine | CGNVEKSRQRRSRHFAVLTYSMYAPRVKMAVALLEGLF* |
| Ga0118731_1143329992 | 3300010392 | Marine | GNVEKSRQRRSRHFAVLTYSMYAPRNKIAVALLDGLF* |
| Ga0118733_1003612222 | 3300010430 | Marine Sediment | MGNYLDGNVEKTRQRRSRHFAVLTYSMYAPRGKMAAALLDGLF* |
| Ga0118733_1011987401 | 3300010430 | Marine Sediment | MSEKGNVEKSRQRRSRHFAVLTYSMYAPRVKMAAALLDGLF* |
| Ga0118733_1016788303 | 3300010430 | Marine Sediment | GNVEKSRQRRSRHFAVLTYSMYAPRVKIAAALLDGLI* |
| Ga0118733_1031850662 | 3300010430 | Marine Sediment | DGNVEKSRQRRSRHFAVLTYSMYAPRVKMAAALLGELF* |
| Ga0118733_1056854532 | 3300010430 | Marine Sediment | NGNVEKSRQRRSRHFAVLTYLMYAPRVKIAVALLDGLF* |
| Ga0139247_11426022 | 3300010967 | Hydrothermal Chimney Microbial Mat | GNVEKSRQQRSRPLAVLAYEEYAPRVKRAAALLDELF* |
| Ga0139250_10153134 | 3300010968 | Hydrothermal Chimney Microbial Mat | NVEKSHQRRSRPFAVLTYWKYAPRVKTAAALLDGLF* |
| Ga0139250_10554802 | 3300010968 | Hydrothermal Chimney Microbial Mat | KVEKSRQRRSHPCPVLTYWKYAPRVKRAAALLDELF* |
| Ga0139246_10407781 | 3300010969 | Hydrothermal Chimney Microbial Mat | CGNVAKSRQRRSRHCVMLTYYEYAPRVKMAAALLDELF* |
| Ga0139246_10698281 | 3300010969 | Hydrothermal Chimney Microbial Mat | NVEKSRQRRSRPFAVLTYWEYAPRIKRAAALLNGLF* |
| Ga0114947_100117315 | 3300011112 | Deep Subsurface | IWKKALQTGNVEKSRQRRSRHFAVLTYSMYAPRLKMAAALLDGLF* |
| Ga0114947_102477962 | 3300011112 | Deep Subsurface | MAGNVEKSRQRRSRPFAVLTYYEYAPRVKRAAALLDE |
| Ga0114947_108428881 | 3300011112 | Deep Subsurface | VEKSRQRRSRPFAVLTYYEYAPRVKRAAALLDGLF* |
| Ga0114947_108572862 | 3300011112 | Deep Subsurface | GNVEKSRQRRSRHFAVLTYGAYAPRVKMAAALLDGLF* |
| Ga0114947_113603072 | 3300011112 | Deep Subsurface | GNVEKSRQRRSRPFAVLTYYEYAPLVKMAAALLDELF* |
| Ga0114947_113780971 | 3300011112 | Deep Subsurface | DMAGNVEKSRQRRSRPFAVLTYYEYAPRVKRAAALLDGLF* |
| Ga0114947_113871741 | 3300011112 | Deep Subsurface | GNVEKSRQRRSRPFAVLTYWEYAPRVKTAAALLDELF* |
| Ga0114947_114666531 | 3300011112 | Deep Subsurface | QDTPPCSGSSGNVEKSRQRRSRHFAVLAYSMYAPRVKMAAALLDELF* |
| Ga0212167_11372561 | 3300020230 | Sediment | MNVGNVEKSRQRRSRHFAVLTYSMYAPRVKMAAALLDGLF |
| Ga0212168_12326586 | 3300020231 | Sediment | MKKELPQGNVEKSRQRRSRPFAVLTYYEYAPRVKMAAALLDELF |
| Ga0212168_12694151 | 3300020231 | Sediment | TGNVEKSRQRRSRPFAVLTYYEYAPLVKRAAALLDELF |
| Ga0212168_13066842 | 3300020231 | Sediment | MKGNVEKSRQRRSRPFAVLTYWEYAPRVKTAAALLDELF |
| Ga0212168_14118482 | 3300020231 | Sediment | GNVEKSRQRRSRHFAVLTYGGYAPRVKMAAALLGGLF |
| Ga0212168_14148061 | 3300020231 | Sediment | HGNVEKSRQRRSRHFAVLTYSLYAPRVKMAAALLDGLF |
| Ga0212226_1483562 | 3300020232 | Sediment | MMTGMVDGNVEKSRQRRSRPFAVLTYYEYAPRVKRAAALLDGLF |
| Ga0212226_1755903 | 3300020232 | Sediment | MKKELPQGNVEKSRQRRSRPFALLTYYEYAPRAKRAAALLDELF |
| Ga0212227_13099763 | 3300020234 | Sediment | TSGNVEKSRQRRSRPFAVLTYYEYAPRVKRAAALLDGLF |
| Ga0212227_13803293 | 3300020234 | Sediment | MGNIEKSRQRRSRHFAVLTYSMYAPRVKMAAALLDGLF |
| Ga0212228_11405713 | 3300020235 | Sediment | MKFDPLLVHKGNVEKSRQRRSHHFAVLTYWEYAPRAKRAAALLDGLF |
| Ga0212228_11555777 | 3300020235 | Sediment | GNVEKSRQRRSRHFAVLTYSMYAPRVKMAAALLDGLF |
| Ga0212228_14530591 | 3300020235 | Sediment | KDASGNVEKSRQRRSRHFAVLTYYEYAPRVKMVAALLDGLF |
| Ga0210351_12975961 | 3300021316 | Estuarine | MGAVEKSRQWRSRQFSVLTYWKYAPRAKLAAAFPS |
| Ga0224503_101729262 | 3300022201 | Sediment | MPHYDVGNVEKSHQRRSRNFVVLTYWQYAPRIKIAAALL |
| Ga0224503_102445052 | 3300022201 | Sediment | GLGNVEKSRQRRSRHFAVLTYSMYAPRVKMAAALLDGLF |
| Ga0224498_100568314 | 3300022202 | Sediment | HYGSVEKSHQRRSRQFPVLTYWKYAPRLKLAVALLDELF |
| Ga0224498_100735361 | 3300022202 | Sediment | MKIGSIEKSRQRRSRHFSVLTYSVYAPRTKMAVALLGGL |
| Ga0224498_100860351 | 3300022202 | Sediment | RGNVEKSRQRRSRHCAVLTYLMYAPRVKMAAALLDGLF |
| Ga0224498_100908562 | 3300022202 | Sediment | MGNVEKSRQRRSRHFAVLTYSMYAPRVKMAAALLD |
| Ga0224498_101560682 | 3300022202 | Sediment | MDLEGVNQGNVEKSRQRRSRHVAVLTYYEYAPRVNMAAALLDELF |
| Ga0224498_101613882 | 3300022202 | Sediment | NVEKSRQRRSRSFAVLTYCEYAPRLKRAAALLDELF |
| Ga0224498_101768881 | 3300022202 | Sediment | MLTWRFQIGNVEKSRQRRSRHFAVLTYFMYAPRVKMAAALLDE |
| Ga0224498_102237782 | 3300022202 | Sediment | GAKECGNVEKSRQRRSRHFAVLTYFMYAPRVKMAAALLDGPF |
| Ga0224496_100822221 | 3300022204 | Sediment | GQMNRNPVPIIFPHQGAVEKSRQRRSHQFSVLTYWKYAPRAKPAAALLNELF |
| Ga0224496_103888761 | 3300022204 | Sediment | VEKSRQRRSHQFSVLTYWKYAPRAKLAAALLDELF |
| Ga0224499_100175074 | 3300022206 | Sediment | MSMNGNVEKSRQRRSRPFAVLTYSIYAPRVKMAAALLDGLF |
| Ga0224499_100236572 | 3300022206 | Sediment | MLTWRFQIGNVEKSRQRRSRHFAVLTYFMYAPRVKMAAALLDELF |
| Ga0224499_100243191 | 3300022206 | Sediment | LKKFEKGNVEKSRQRRSRPFAVLTYSMYAPRVKMAAALLDGLF |
| Ga0224499_103088691 | 3300022206 | Sediment | MVKGNGENSRQRRSRHFAVLTYSTYAPRVKIAAALLDELF |
| Ga0224513_101358502 | 3300022220 | Sediment | VIAPQTGTTTGFDQGNVEKIRQRRSRHFAVLTYAMYAPRVKMAAALLDGLF |
| Ga0224513_102998292 | 3300022220 | Sediment | IEKNRQLRSRQIPVLTYEGYAPRQNLAAALLDGLF |
| Ga0224513_103675091 | 3300022220 | Sediment | VGKSRQRGSRNFAVLTYCQHAPRVKMAAALLNGLF |
| Ga0224501_103857741 | 3300022223 | Sediment | MGAVEKSRQRRSHQFSVLTYWKYAPRAKQAAALLDELF |
| Ga0224501_105288152 | 3300022223 | Sediment | HVDSQMVNGAVEKSCQVRSRHFSVLTYWKYALRAKMTAALLDGLF |
| Ga0224512_103253362 | 3300022226 | Sediment | VIDNGNVEKSRQWRSREFVVLTYWKYAPRVKLTAALLDDFF |
| Ga0224509_102811771 | 3300022306 | Sediment | PINGQHGNVEKSRQRRSRHFAVLSYSMYASRVKMAAALLDGLF |
| Ga0210364_11795571 | 3300022396 | Estuarine | NVEKSRQRRSRHFAVLTYFTYAPRTKIAAALLDGLF |
| Ga0224508_101407782 | 3300022413 | Sediment | MDLGGVNQGNVEKSRQRRSRHVAVLTYYEYAPRVNMAAALLDELF |
| Ga0224508_101822871 | 3300022413 | Sediment | SRALSNGNVEKSHQRRSPHFAVLTYAMYAPRVKMAAALLDGLF |
| Ga0224508_105079112 | 3300022413 | Sediment | RNGNVEKSRQRRSRHFAVLTYSMYAPRVKMAAVLLDGLF |
| Ga0209997_100615911 | 3300024058 | Deep Subsurface | IENGRQRRSPHFAVLTYSMHAPRVKIAVALLDGPF |
| Ga0209987_102688751 | 3300024060 | Deep Subsurface | NVEKSRQRRSRHFAVLTYYEYAPRVKRAAALLDGLF |
| Ga0209987_105968151 | 3300024060 | Deep Subsurface | NVEKSRQRRSRHFAVLTYSMYAPRVKMAAALLDGLF |
| Ga0209988_100133941 | 3300024431 | Deep Subsurface | SRMVFFGNVEKSRQRRSRHFAVLTYYEYAPRVKRAAALLDGLF |
| Ga0209988_101379952 | 3300024431 | Deep Subsurface | MGNVEKSRQRRSRHFAVLTYSMYAPRVKMAAALLDGLF |
| Ga0209988_106090011 | 3300024431 | Deep Subsurface | NPNGNVEKSRQRRSRPFAVLTYYEYAPRVKRAAALLDELF |
| Ga0209980_1000183616 | 3300024516 | Deep Subsurface | VEKSRQRRSRHFAVLTYSMYAPRVKMAAALLDELF |
| Ga0209980_100029121 | 3300024516 | Deep Subsurface | MNIGKVEKSFQRRSHHFVVLTYSMYVPRVKMTAALLDELF |
| Ga0209980_100420171 | 3300024516 | Deep Subsurface | MKKELPQGNVEKSRQRRSRHFAVLTYYEYAPRVKMAAALL |
| Ga0209980_100680525 | 3300024516 | Deep Subsurface | MLRISFYGNVEKSRQRRSRHFAVLTYYEYAPRVKMAAAL |
| Ga0209980_101755462 | 3300024516 | Deep Subsurface | YGCVEKVRQQRSRHFDVLTYSMYAPRVKMAAALLDGLF |
| Ga0209980_101848751 | 3300024516 | Deep Subsurface | VGKSRQRRSRHFAVLTYSLYAPRVKMAAALLDGLF |
| Ga0209980_103670142 | 3300024516 | Deep Subsurface | CTTFDNGNVEKSRQRRSRHFAVLRYSMYAPLVKMAAALLDGLF |
| (restricted) Ga0255056_103328672 | 3300024521 | Seawater | FEKSSQRRSRPFAVLTYYEYAPRVQRAAALLDGLF |
| (restricted) Ga0255056_104132541 | 3300024521 | Seawater | DVGNVEKNRQRRSRHFAVLTYSMYAPRVKMAAALLDGLF |
| Ga0210039_13609661 | 3300025835 | Groundwater | RFDVHLGSVEKSRQRRSRHFFVLTYYAYAPRVKTAAALLDGLF |
| Ga0209456_100538981 | 3300025883 | Pelagic Marine | MGNYLDGNVEKTRQRRSRHFAVLTYSMYAPRIKMAAALLDGL |
| Ga0209456_101429712 | 3300025883 | Pelagic Marine | MLPIIHFGNVEKSRQRRSRYFAVLTYSMYAPRVKMAAALLDALF |
| Ga0209567_106200812 | 3300025895 | Pelagic Marine | GSVEKSRQRRSRHFSVLTYGMYAPRAKMAAALLDGLF |
| Ga0209379_101404711 | 3300027758 | Marine Sediment | GGFFSGNVEKSRQRRSRHCAVLTYLMYAPRVKMAAALLDGLF |
| Ga0209578_103671242 | 3300027820 | Marine Sediment | MRGVKGNVEKSRQRRSRYFAVLTYLMYAPRDKMAAALLDSHF |
| Ga0209271_101889912 | 3300027845 | Marine Sediment | IGFVKPIGSVEKSRQRRSRHFSVLTYGMYAPRAKMSAALLDGLF |
| Ga0209165_101343621 | 3300027978 | Marine Sediment | VVNGNFEKSRQRRSRPFAVLTYYEYAPRVKRAAALLDGLF |
| Ga0209165_101466072 | 3300027978 | Marine Sediment | MKPANQGNVEKIHQRRSRHFVVLTYWKYAPRVKIAAA |
| Ga0256830_10206771 | 3300028399 | Hydrothermal Vents | LLLIQDAFLIGNVEKSRQRRSRRFAVLTYAAYAPPVKTAAALLDGLF |
| Ga0256830_11008842 | 3300028399 | Hydrothermal Vents | VEKSRQRRSRRFAVLTYEAYAPRVKTAAALLDGLF |
| Ga0210366_101818621 | 3300028420 | Estuarine | MGMLKKSRQQRSRHFAVLTYSMYAPRVKMAAALLDGLF |
| Ga0210366_102126261 | 3300028420 | Estuarine | CTSASKLLMGNVEKSRQGRPRHFDVLTYAMYAPRVKMTAALLDGLF |
| Ga0210366_102172122 | 3300028420 | Estuarine | MLSRYHSNGAIENSRQRRSPHFSVLTYRKYALREKMAAALLDELF |
| Ga0210366_102501451 | 3300028420 | Estuarine | GNVEKSRQRRSRHCAVLTYLMYAPRVKMAAALMDGLF |
| Ga0265306_100828702 | 3300028598 | Sediment | PLSLLGIIIYGNVEKSRQRRSRPFAVLSYSMYAPRVKMAAALLDGLF |
| Ga0265309_107973083 | 3300028599 | Sediment | KRRRSSSAGGNVEKSRQQRSRHFAVLTYSMYAPRIKMVAALLDGLF |
| Ga0265309_109059851 | 3300028599 | Sediment | MDLEGVNRGNVEKSRQRRSRHVAVLTYCEYAPRVNKGSSLR |
| Ga0265303_104147332 | 3300028600 | Sediment | GNVEKSRQRRSRYFVVLTYSVYAPRDKKAAALLDEFF |
| Ga0265303_112527231 | 3300028600 | Sediment | GGTILSMDLEGVNRGNVEKSRQRRSRHVAVLTYCEYAPRVNIAAALLDGLF |
| Ga0119873_10287421 | 3300029948 | Activated Sludge | VEAVEKSRQLRSSHFSLLTYWKYAPREKLTAALLDELF |
| Ga0316190_104185972 | 3300032259 | Worm Burrow | MDLEGVNRGNVEKSRQRRSRHVAVLTYCEYAPRVNMAVA |
| Ga0316190_109047112 | 3300032259 | Worm Burrow | MLSSFFLSGPVEKSRQRRSHQFSVLTYWKYAPRAKLAAALLDELF |
| ⦗Top⦘ |