


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300028399 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0046784 | Gp0296295 | Ga0256830 |
| Sample Name | Hydrothermal vent microbial communities from Lau Basin, Pacific Ocean - 128-326 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 512596221 |
| Sequencing Scaffolds | 7 |
| Novel Protein Genes | 7 |
| Associated Families | 6 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1 |
| All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1 |
| All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → Nitrospinia → Nitrospinales → Nitrospinaceae → Nitrospina | 1 |
| All Organisms → cellular organisms → Bacteria | 2 |
| All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium Pan216 | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine hydrothermal vent biome → marine hydrothermal vent → rock |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Pacific Ocean: Lau Basin | |||||||
| Coordinates | Lat. (o) | -20.761 | Long. (o) | -176.1909 | Alt. (m) | N/A | Depth (m) | 2138 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F032091 | Metagenome / Metatranscriptome | 181 | Y |
| F035771 | Metagenome / Metatranscriptome | 171 | Y |
| F039145 | Metagenome / Metatranscriptome | 164 | Y |
| F049640 | Metagenome / Metatranscriptome | 146 | Y |
| F064726 | Metagenome / Metatranscriptome | 128 | Y |
| F083231 | Metagenome / Metatranscriptome | 113 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0256830_1000919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 21891 | Open in IMG/M |
| Ga0256830_1020677 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 3049 | Open in IMG/M |
| Ga0256830_1046757 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1751 | Open in IMG/M |
| Ga0256830_1058947 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → Nitrospinia → Nitrospinales → Nitrospinaceae → Nitrospina | 1481 | Open in IMG/M |
| Ga0256830_1089555 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| Ga0256830_1100884 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| Ga0256830_1216328 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium Pan216 | 558 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0256830_1000919 | Ga0256830_100091916 | F039145 | MKSFLVSLFLSLCLLAGCTQQDMKIPLELSGFIEELKANGVDGTLLIRAPFNEDMEYVAEYTIARYASTRIISLFKFKDAGKAEKNLQDALKNDKLSGQASNGAFVMAATFYPPDEEAVEKIKALFLAHEFQ |
| Ga0256830_1020677 | Ga0256830_10206771 | F035771 | LLLIQDAFLIGNVEKSRQRRSRRFAVLTYAAYAPPVKTAAALLDGLF |
| Ga0256830_1046757 | Ga0256830_10467571 | F064726 | MMATIEVASEGTTNQRKFRSPNRILVRSFRLSRDKWKLKYMDTRADLKRSRQLATERGNSRDRWRAECDAAKEQAHAAEALAQERLVELEQLRASEAELKKTLLADAS |
| Ga0256830_1058947 | Ga0256830_10589474 | F083231 | MASKDGKLFDTIVLIGLGVNALMAVYLLLMYFEVI |
| Ga0256830_1089555 | Ga0256830_10895552 | F032091 | IYDHLDLDIQYQHSDLFLDICKTVDEIDDERASLVLSYGHQMIEHIWMWTENIWSYYSNKNNPVPARTFDYYRD |
| Ga0256830_1100884 | Ga0256830_11008842 | F035771 | VEKSRQRRSRRFAVLTYEAYAPRVKTAAALLDGLF |
| Ga0256830_1216328 | Ga0256830_12163281 | F049640 | MARQIRLELLPHERAALLKVNFTIDEVRAQLQACAWSEDIETITMTSVDVHWLAGDLTHAIVKQGCRDQDVIELSERLDYVDDSGDGSFDGWYS |
| ⦗Top⦘ |