NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300028399

3300028399: Hydrothermal vent microbial communities from Lau Basin, Pacific Ocean - 128-326



Overview

Basic Information
IMG/M Taxon OID3300028399 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0046784 | Gp0296295 | Ga0256830
Sample NameHydrothermal vent microbial communities from Lau Basin, Pacific Ocean - 128-326
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size512596221
Sequencing Scaffolds7
Novel Protein Genes7
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1
All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis1
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1
All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → Nitrospinia → Nitrospinales → Nitrospinaceae → Nitrospina1
All Organisms → cellular organisms → Bacteria2
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium Pan2161

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine hydrothermal vent biome → marine hydrothermal vent → rock
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationPacific Ocean: Lau Basin
CoordinatesLat. (o)-20.761Long. (o)-176.1909Alt. (m)N/ADepth (m)2138
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032091Metagenome / Metatranscriptome181Y
F035771Metagenome / Metatranscriptome171Y
F039145Metagenome / Metatranscriptome164Y
F049640Metagenome / Metatranscriptome146Y
F064726Metagenome / Metatranscriptome128Y
F083231Metagenome / Metatranscriptome113Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0256830_1000919All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria21891Open in IMG/M
Ga0256830_1020677All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis3049Open in IMG/M
Ga0256830_1046757All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1751Open in IMG/M
Ga0256830_1058947All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → Nitrospinia → Nitrospinales → Nitrospinaceae → Nitrospina1481Open in IMG/M
Ga0256830_1089555All Organisms → cellular organisms → Bacteria1085Open in IMG/M
Ga0256830_1100884All Organisms → cellular organisms → Bacteria992Open in IMG/M
Ga0256830_1216328All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium Pan216558Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0256830_1000919Ga0256830_100091916F039145MKSFLVSLFLSLCLLAGCTQQDMKIPLELSGFIEELKANGVDGTLLIRAPFNEDMEYVAEYTIARYASTRIISLFKFKDAGKAEKNLQDALKNDKLSGQASNGAFVMAATFYPPDEEAVEKIKALFLAHEFQ
Ga0256830_1020677Ga0256830_10206771F035771LLLIQDAFLIGNVEKSRQRRSRRFAVLTYAAYAPPVKTAAALLDGLF
Ga0256830_1046757Ga0256830_10467571F064726MMATIEVASEGTTNQRKFRSPNRILVRSFRLSRDKWKLKYMDTRADLKRSRQLATERGNSRDRWRAECDAAKEQAHAAEALAQERLVELEQLRASEAELKKTLLADAS
Ga0256830_1058947Ga0256830_10589474F083231MASKDGKLFDTIVLIGLGVNALMAVYLLLMYFEVI
Ga0256830_1089555Ga0256830_10895552F032091IYDHLDLDIQYQHSDLFLDICKTVDEIDDERASLVLSYGHQMIEHIWMWTENIWSYYSNKNNPVPARTFDYYRD
Ga0256830_1100884Ga0256830_11008842F035771VEKSRQRRSRRFAVLTYEAYAPRVKTAAALLDGLF
Ga0256830_1216328Ga0256830_12163281F049640MARQIRLELLPHERAALLKVNFTIDEVRAQLQACAWSEDIETITMTSVDVHWLAGDLTHAIVKQGCRDQDVIELSERLDYVDDSGDGSFDGWYS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.