Metagenome / Metatranscriptome Family F033813

Basic Information
Family ID	F033813
Family Type	Metagenome / Metatranscriptome
Number of Sequences	176
Average Sequence Length	36 residues
Representative Sequence	SWDAGGGRKKVAGVPRIIPGDWGKVESGWLAQPL
Number of Associated Samples	125
Number of Associated Scaffolds	176

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	98.86 %
% of genes from short scaffolds (< 2000 bps)	98.86 %
Associated GOLD sequencing projects	122
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.15

Most Common Taxonomy
Group	Unclassified (99.432 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil (31.818 % of family members)
Environment Ontology (ENVO)	Unclassified (35.795 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (74.432 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 176 Family Scaffolds
PF01494	FAD_binding_3	0.57

COG ID	Name	Functional Category	% Frequency in 176 Family Scaffolds
COG0654	2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases	Energy production and conversion [C]	1.14
COG0578	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	0.57
COG0644	Dehydrogenase (flavoprotein)	Energy production and conversion [C]	0.57
COG0665	Glycine/D-amino acid oxidase (deaminating)	Amino acid transport and metabolism [E]	0.57

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.43 %
All Organisms	root	All Organisms	0.57 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.43 %
cellular organisms	root	All Organisms → cellular organisms	0.57 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.43 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.57 %

Scaffold	Taxonomy	Length	IMG/M Link
3300001448\|JGI20219J14954_1004152	Not Available	821	Open in IMG/M
3300002653\|Ga0005486J37273_101735	Not Available	518	Open in IMG/M
3300002673\|Ga0005480J37268_100680	Not Available	666	Open in IMG/M
3300004118\|Ga0058886_1014786	Not Available	835	Open in IMG/M
3300006423\|Ga0075039_1003136	Not Available	564	Open in IMG/M
3300006860\|Ga0063829_1016635	Not Available	811	Open in IMG/M
3300006860\|Ga0063829_1032923	Not Available	500	Open in IMG/M
3300006860\|Ga0063829_1034413	Not Available	825	Open in IMG/M
3300006861\|Ga0063777_1017046	Not Available	810	Open in IMG/M
3300006861\|Ga0063777_1032490	Not Available	739	Open in IMG/M
3300006861\|Ga0063777_1040404	Not Available	782	Open in IMG/M
3300008785\|Ga0103638_1002852	Not Available	589	Open in IMG/M
3300009225\|Ga0103851_1077690	Not Available	584	Open in IMG/M
3300009239\|Ga0103858_10122057	Not Available	661	Open in IMG/M
3300010078\|Ga0127487_137372	Not Available	629	Open in IMG/M
3300010118\|Ga0127465_1103023	Not Available	799	Open in IMG/M
3300010144\|Ga0115593_1078962	Not Available	759	Open in IMG/M
3300010147\|Ga0126319_1243430	Not Available	788	Open in IMG/M
3300010164\|Ga0063827_189403	Not Available	793	Open in IMG/M
3300010854\|Ga0126360_1016739	Not Available	776	Open in IMG/M
3300010854\|Ga0126360_1063483	Not Available	671	Open in IMG/M
3300010857\|Ga0126354_1114259	Not Available	753	Open in IMG/M
3300010857\|Ga0126354_1163500	Not Available	816	Open in IMG/M
3300010858\|Ga0126345_1006412	Not Available	802	Open in IMG/M
3300010858\|Ga0126345_1173257	Not Available	799	Open in IMG/M
3300010859\|Ga0126352_1024990	Not Available	520	Open in IMG/M
3300010859\|Ga0126352_1155005	Not Available	542	Open in IMG/M
3300010859\|Ga0126352_1190720	Not Available	821	Open in IMG/M
3300010860\|Ga0126351_1007183	Not Available	816	Open in IMG/M
3300010860\|Ga0126351_1049268	Not Available	709	Open in IMG/M
3300010860\|Ga0126351_1067592	Not Available	815	Open in IMG/M
3300010860\|Ga0126351_1147398	Not Available	545	Open in IMG/M
3300010860\|Ga0126351_1180581	Not Available	807	Open in IMG/M
3300010860\|Ga0126351_1183308	Not Available	817	Open in IMG/M
3300010860\|Ga0126351_1233866	Not Available	797	Open in IMG/M
3300010860\|Ga0126351_1315626	Not Available	812	Open in IMG/M
3300010862\|Ga0126348_1015874	Not Available	811	Open in IMG/M
3300010864\|Ga0126357_1143991	Not Available	812	Open in IMG/M
3300010864\|Ga0126357_1149720	Not Available	801	Open in IMG/M
3300010864\|Ga0126357_1216649	Not Available	800	Open in IMG/M
3300010865\|Ga0126346_1061586	Not Available	782	Open in IMG/M
3300010867\|Ga0126347_1099129	Not Available	753	Open in IMG/M
3300010867\|Ga0126347_1369608	Not Available	793	Open in IMG/M
3300010869\|Ga0126359_1108823	Not Available	814	Open in IMG/M
3300010869\|Ga0126359_1368432	Not Available	781	Open in IMG/M
3300010877\|Ga0126356_10884825	Not Available	798	Open in IMG/M
3300011014\|Ga0138596_103600	Not Available	550	Open in IMG/M
3300011014\|Ga0138596_106545	Not Available	524	Open in IMG/M
3300011014\|Ga0138596_123915	Not Available	812	Open in IMG/M
3300011015\|Ga0138535_101973	Not Available	788	Open in IMG/M
3300011020\|Ga0138602_102405	Not Available	552	Open in IMG/M
3300011020\|Ga0138602_112665	Not Available	523	Open in IMG/M
3300011024\|Ga0138530_103334	Not Available	714	Open in IMG/M
3300011029\|Ga0138551_103938	Not Available	760	Open in IMG/M
3300011030\|Ga0138603_125221	Not Available	621	Open in IMG/M
3300011032\|Ga0138546_106130	Not Available	781	Open in IMG/M
3300011032\|Ga0138546_127830	Not Available	625	Open in IMG/M
3300011036\|Ga0138590_130080	Not Available	548	Open in IMG/M
3300011040\|Ga0138587_111393	Not Available	815	Open in IMG/M
3300011041\|Ga0138591_136614	Not Available	762	Open in IMG/M
3300011045\|Ga0138598_137075	Not Available	511	Open in IMG/M
3300011045\|Ga0138598_143860	Not Available	524	Open in IMG/M
3300011046\|Ga0138600_119434	Not Available	740	Open in IMG/M
3300011046\|Ga0138600_131723	Not Available	780	Open in IMG/M
3300011048\|Ga0138556_148173	Not Available	782	Open in IMG/M
3300011050\|Ga0138571_121199	Not Available	520	Open in IMG/M
3300011050\|Ga0138571_126574	Not Available	531	Open in IMG/M
3300011051\|Ga0138540_102962	Not Available	530	Open in IMG/M
3300011051\|Ga0138540_145721	Not Available	783	Open in IMG/M
3300011051\|Ga0138540_174588	Not Available	610	Open in IMG/M
3300011053\|Ga0138531_134499	Not Available	733	Open in IMG/M
3300011056\|Ga0138538_1025880	Not Available	738	Open in IMG/M
3300011059\|Ga0138597_1037450	Not Available	763	Open in IMG/M
3300011060\|Ga0138583_1054816	Not Available	808	Open in IMG/M
3300011066\|Ga0138524_1030196	Not Available	790	Open in IMG/M
3300011067\|Ga0138594_1131464	Not Available	792	Open in IMG/M
3300011069\|Ga0138592_1012550	Not Available	814	Open in IMG/M
3300011069\|Ga0138592_1068575	Not Available	558	Open in IMG/M
3300011069\|Ga0138592_1076323	Not Available	806	Open in IMG/M
3300011071\|Ga0138595_1008618	Not Available	556	Open in IMG/M
3300011075\|Ga0138555_1003074	Not Available	777	Open in IMG/M
3300011075\|Ga0138555_1122272	Not Available	765	Open in IMG/M
3300011075\|Ga0138555_1153244	Not Available	780	Open in IMG/M
3300011076\|Ga0138574_1025214	Not Available	709	Open in IMG/M
3300011078\|Ga0138565_1028952	Not Available	802	Open in IMG/M
3300011083\|Ga0138560_1068753	Not Available	713	Open in IMG/M
3300011083\|Ga0138560_1094963	Not Available	571	Open in IMG/M
3300011083\|Ga0138560_1105291	Not Available	797	Open in IMG/M
3300011084\|Ga0138562_1056557	Not Available	582	Open in IMG/M
3300011088\|Ga0138576_1045525	Not Available	820	Open in IMG/M
3300011089\|Ga0138573_1023536	Not Available	509	Open in IMG/M
3300011089\|Ga0138573_1156454	Not Available	794	Open in IMG/M
3300011090\|Ga0138579_1107637	Not Available	712	Open in IMG/M
3300011110\|Ga0138578_1115069	Not Available	637	Open in IMG/M
3300011120\|Ga0150983_11609217	Not Available	631	Open in IMG/M
3300011120\|Ga0150983_12488269	Not Available	817	Open in IMG/M
3300011120\|Ga0150983_12732215	Not Available	807	Open in IMG/M
3300011120\|Ga0150983_12750031	Not Available	793	Open in IMG/M
3300011120\|Ga0150983_13984349	Not Available	813	Open in IMG/M
3300011120\|Ga0150983_15899329	Not Available	774	Open in IMG/M
3300011120\|Ga0150983_16326284	Not Available	822	Open in IMG/M
3300011120\|Ga0150983_16441766	Not Available	798	Open in IMG/M
3300011120\|Ga0150983_16521304	Not Available	548	Open in IMG/M
3300012212\|Ga0150985_104445198	Not Available	692	Open in IMG/M
3300012212\|Ga0150985_108590933	Not Available	610	Open in IMG/M
3300012373\|Ga0134042_1124995	Not Available	718	Open in IMG/M
3300012409\|Ga0134045_1440775	Not Available	614	Open in IMG/M
3300012469\|Ga0150984_103776736	Not Available	810	Open in IMG/M
3300012778\|Ga0138269_1251747	Not Available	745	Open in IMG/M
3300016705\|Ga0181507_1106304	Not Available	742	Open in IMG/M
3300016705\|Ga0181507_1150370	Not Available	709	Open in IMG/M
3300019160\|Ga0184577_109720	Not Available	811	Open in IMG/M
3300019181\|Ga0184594_107149	Not Available	793	Open in IMG/M
3300019186\|Ga0184588_145841	Not Available	814	Open in IMG/M
3300019211\|Ga0187799_1217929	Not Available	527	Open in IMG/M
3300019275\|Ga0187798_1870808	Not Available	565	Open in IMG/M
3300019278\|Ga0187800_1279181	Not Available	551	Open in IMG/M
3300019278\|Ga0187800_1545050	Not Available	637	Open in IMG/M
3300019284\|Ga0187797_1293849	Not Available	814	Open in IMG/M
3300021307\|Ga0179585_1119297	Not Available	754	Open in IMG/M
3300021857\|Ga0213849_1062167	Not Available	741	Open in IMG/M
3300021857\|Ga0213849_1169162	Not Available	557	Open in IMG/M
3300021861\|Ga0213853_10573199	Not Available	551	Open in IMG/M
3300022498\|Ga0242644_1008211	Not Available	891	Open in IMG/M
3300022502\|Ga0242646_1008793	Not Available	813	Open in IMG/M
3300022522\|Ga0242659_1112660	Not Available	549	Open in IMG/M
3300022525\|Ga0242656_1044509	Not Available	753	Open in IMG/M
3300022529\|Ga0242668_1053772	Not Available	725	Open in IMG/M
3300022708\|Ga0242670_1018550	Not Available	811	Open in IMG/M
3300022708\|Ga0242670_1073753	Not Available	525	Open in IMG/M
3300022708\|Ga0242670_1077455	Not Available	516	Open in IMG/M
3300022709\|Ga0222756_1030002	Not Available	744	Open in IMG/M
3300022711\|Ga0242674_1024013	Not Available	731	Open in IMG/M
3300022712\|Ga0242653_1030559	Not Available	804	Open in IMG/M
3300022714\|Ga0242671_1028592	Not Available	828	Open in IMG/M
3300023536\|Ga0247552_103043	Not Available	567	Open in IMG/M
3300023541\|Ga0247544_100568	Not Available	812	Open in IMG/M
3300023551\|Ga0247546_101276	Not Available	848	Open in IMG/M
3300023669\|Ga0247539_100894	Not Available	784	Open in IMG/M
3300024553\|Ga0255301_1043745	Not Available	812	Open in IMG/M
3300028450\|Ga0189898_1018038	Not Available	716	Open in IMG/M
3300029701\|Ga0222748_1089488	Not Available	585	Open in IMG/M
3300030531\|Ga0210274_1323254	Not Available	809	Open in IMG/M
3300030548\|Ga0210252_11098028	Not Available	588	Open in IMG/M
3300030582\|Ga0210261_1064985	Not Available	750	Open in IMG/M
3300030627\|Ga0210269_10297372	Not Available	561	Open in IMG/M
3300030629\|Ga0210268_1130335	Not Available	736	Open in IMG/M
3300030716\|Ga0307920_130825	Not Available	518	Open in IMG/M
3300030730\|Ga0307482_1085557	Not Available	838	Open in IMG/M
3300030730\|Ga0307482_1116113	Not Available	749	Open in IMG/M
3300030761\|Ga0265722_102385	Not Available	713	Open in IMG/M
3300030762\|Ga0265775_103244	All Organisms → cellular organisms → Bacteria	873	Open in IMG/M
3300030777\|Ga0075402_12497684	Not Available	620	Open in IMG/M
3300030836\|Ga0265767_104706	Not Available	809	Open in IMG/M
3300030843\|Ga0075392_11311600	Not Available	590	Open in IMG/M
3300030874\|Ga0265742_1018074	Not Available	584	Open in IMG/M
3300030902\|Ga0308202_1162183	Not Available	504	Open in IMG/M
3300030940\|Ga0265740_1011577	Not Available	812	Open in IMG/M
3300030942\|Ga0247549_101665	Not Available	752	Open in IMG/M
3300030963\|Ga0265768_103890	Not Available	820	Open in IMG/M
3300030975\|Ga0099845_1026466	Not Available	802	Open in IMG/M
3300030988\|Ga0308183_1216940	Not Available	505	Open in IMG/M
3300030990\|Ga0308178_1075765	Not Available	676	Open in IMG/M
3300031010\|Ga0265771_1002990	Not Available	944	Open in IMG/M
3300031041\|Ga0265755_106143	Not Available	704	Open in IMG/M
3300031057\|Ga0170834_109973926	Not Available	816	Open in IMG/M
3300031090\|Ga0265760_10130967	Not Available	811	Open in IMG/M
3300031114\|Ga0308187_10135925	Not Available	805	Open in IMG/M
3300031421\|Ga0308194_10172401	Not Available	682	Open in IMG/M
3300031590\|Ga0307483_1010169	Not Available	817	Open in IMG/M
3300031592\|Ga0310117_129072	Not Available	538	Open in IMG/M
3300031809\|Ga0316048_103675	Not Available	730	Open in IMG/M
3300032120\|Ga0316053_105316	Not Available	814	Open in IMG/M
3300032121\|Ga0316040_104664	Not Available	843	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	98.30%
Host-Associated	Host-Associated	1.70%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	91.48%
Aquatic	Environmental → Aquatic	6.82%
Plants	Host-Associated → Plants	1.70%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	91.48%
Freshwater	Environmental → Aquatic → Freshwater	6.82%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.14%
Rhizosphere	Host-Associated → Plants → Rhizosphere	0.57%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	80.11%
Loam	Environmental → Terrestrial → Soil → Loam	6.82%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	3.98%
Sediment	Environmental → Aquatic → Freshwater → Sediment	2.27%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	1.70%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	1.14%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.14%
Lake	Environmental → Aquatic → Freshwater → Lake	0.57%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.57%
River	Environmental → Aquatic → Freshwater → River	0.57%
Clay	Environmental → Terrestrial → Soil → Clay	0.57%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.57%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	65.91%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	14.20%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	6.82%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	3.41%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	2.27%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	1.14%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	1.14%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.14%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	0.57%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.57%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.57%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	0.57%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	0.57%
Unclassified	Environmental → Terrestrial → Soil → Clay → Unclassified	0.57%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.57%

Habitat	Taxonomy	Distribution
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	31.82%
Boreal Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil	15.91%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	15.34%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	11.93%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	6.82%
Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland	2.84%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	2.27%
Watersheds	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds	1.70%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.70%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	1.14%
River Water	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water	1.14%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	1.14%
Wetland	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland	0.57%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	0.57%
Wetland	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland	0.57%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	0.57%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	0.57%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	0.57%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.57%
Permafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil	0.57%
Soil	Environmental → Terrestrial → Soil → Clay → Unclassified → Soil	0.57%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.57%
Wetland Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Wetland Soil	0.57%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300001448	Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk Metatranscriptome	Environmental	Open in IMG/M
3300002653	Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF135 (Metagenome Metatranscriptome, Counting Only)	Environmental	Open in IMG/M
3300002673	Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF129 (Metagenome Metatranscriptome, Counting Only)	Environmental	Open in IMG/M
3300004118	Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF208 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006423	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_056 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006860	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 63 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006861	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 3 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300008785	Microbial communities from wetland soil in Czech Republic - R1_cDNA	Environmental	Open in IMG/M
3300009225	Microbial communities of water from Amazon river, Brazil - RCM4	Environmental	Open in IMG/M
3300009239	Microbial communities of water from Amazon river, Brazil - RCM11	Environmental	Open in IMG/M
3300010078	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_0_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010118	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_16_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010144	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_11_14_C (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010147	Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010164	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 61 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010854	Boreal forest soil eukaryotic communities from Alaska, USA - W4-3 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300010857	Boreal forest soil eukaryotic communities from Alaska, USA - W1-3 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300010858	Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300010859	Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300010860	Boreal forest soil eukaryotic communities from Alaska, USA - C5-2 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300010862	Boreal forest soil eukaryotic communities from Alaska, USA - C4-4 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300010864	Boreal forest soil eukaryotic communities from Alaska, USA - W3-5 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300010865	Boreal forest soil eukaryotic communities from Alaska, USA - C3-3 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300010867	Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300010869	Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300010877	Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300011014	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 43 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011015	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 13 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011020	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 78 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011024	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 8 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011029	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 32 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011030	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 83 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011032	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 27 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011036	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 82 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011040	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 79 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011041	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 17 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011045	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 66 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011046	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 68 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011048	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 37 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011050	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 56 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011051	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 21 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011053	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 9 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011056	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 16 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011059	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 44 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011060	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 73 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011066	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 3 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011067	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 41 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011069	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 19 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011071	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 42 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011075	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 36 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011076	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 59 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011078	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 50 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011083	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 45 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011084	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011088	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 62 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011089	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011090	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011110	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011120	Combined assembly of Microbial Forest Soil metaT	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012373	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012409	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012778	Freshwater microbial communities from Lake Croche, Canada - C_130208_E_mt (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300016705	Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019160	Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLA1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019181	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZI3 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019186	Soil microbial communities from Bohemian Forest, Czech Republic ? CSE3 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019211	Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019275	Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019278	Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019284	Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021307	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021857	Metatranscriptome of freshwater microbial communities from pre-fracked creek in Pennsylvania, United States - WE:C (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021861	Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300022498	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-O (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022502	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-O (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022509	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022522	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022525	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022529	Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022708	Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022709	Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300022711	Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022712	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022714	Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300023536	Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE4 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300023541	Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSE4 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300023551	Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSA4 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300023669	Metatranscriptome of spruce litter microbial communities from Bohemian Forest, Czech Republic - CLA5 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300024553	Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepC_8d (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300028450	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 63 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300029701	Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030531	Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO038SO (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030548	Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR016SO (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030582	Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO145-ARE022SO (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030627	Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE095SO (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030629	Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE093SO (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030716	Metatranscriptome of soil microbial communities from Risofladan, Vaasa, Finland - OX-2 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030730	Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030761	Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI4 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030762	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030777	Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 SO (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030836	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030843	Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 EcM (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030874	Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI4 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030902	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030940	Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030942	Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI5 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030963	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030975	Forest soil eukaryotic communities from Alaska, USA, for a soil warming experiment in a boreal forest - Alaskan Soil AK pilot (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030988	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030990	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031010	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031041	Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSA1 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031057	Oak Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031090	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031114	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031421	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031590	Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031592	Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031809	Metatranscriptome of spruce litter microbial communities from Bohemian Forest, Czech Republic - CLA5 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300032120	Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300032121	Soil microbial communities from Bohemian Forest, Czech Republic ? CSA3 metaT (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300034447	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_119 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI20219J14954_10041521	3300001448	Wetland	TGTDGGGQQAGAEVPRIRPGDWGKVEAGWLPRPFC*
Ga0005486J37273_1017351	3300002653	Forest Soil	SWNAEGGRKKISGAPRIIPGDWGKVESGWLTQPLKRARKG*
Ga0005480J37268_1006801	3300002673	Forest Soil	SWNAEGGRKKISGVPRIIPGDWGKVVPGWLAQPLKRARKG*
Ga0058886_10147861	3300004118	Forest Soil	KSWNAEGGRKKISGAPRIIPGDWGKVESGWLTQPLKRARKG*
Ga0075039_10031361	3300006423	Permafrost Soil	KSWDAGGGRKKIAGVPRIIPGDWGKAESGWLAQPL*
Ga0063829_10166352	3300006860	Peatlands Soil	SWDVGGGRKKVAGVPRIIPGDWGKVGPGWLARPL*
Ga0063829_10329231	3300006860	Peatlands Soil	SWDAGGGRKKIAGVPRIIPGDWGKAESGWLAQPL*
Ga0063829_10344131	3300006860	Peatlands Soil	KSWDAGGGRKEIVGVPRIIPGDWGKAESGWLAQPL*
Ga0063777_10170461	3300006861	Peatlands Soil	SWDAGGGRKKVAGVPRIIPGDWGKAGPGWLAQPL*
Ga0063777_10324902	3300006861	Peatlands Soil	ELGCSGGRKKIVRVPRIIPGDWGKVEPGWLAQPL*
Ga0063777_10404041	3300006861	Peatlands Soil	KSWDAGDGRKKIACVPRIIPGDWGKVEAGWLAQPL*
Ga0103638_10028521	3300008785	Wetland Soil	GAAGSGRKKVKGVPRIIPGDWGKVGPGWLAQPLEDGFARD*
Ga0103851_10776901	3300009225	River Water	KKVKGSPRIIPGDWGKVEPGWLAQPLEDRFARGGN*
Ga0103858_101220571	3300009239	River Water	GRKKVKGSPRIIPGDWGKVEPGWLAQPLEDRFARSGN*
Ga0127487_1373721	3300010078	Grasslands Soil	SWDAGGGRKKVKRVPRIIPREWGKIEPGWLARSL*
Ga0127465_11030231	3300010118	Grasslands Soil	GNGRKKVKGVPRIIPGDWGKVRPGWLAQPLEDGFARD*
Ga0115593_10789621	3300010144	Wetland	SWDAGSGRKKTASIPRIIPGDWGKIGPGWLAQSLEEPF*
Ga0126319_12434301	3300010147	Soil	IERAEMSGEGRKKFANVSRIIPGDRGKVESGWLARPL*
Ga0063827_1894031	3300010164	Peatlands Soil	SWSAGDGRKKVAGIPRIIPGDWGKVEAGWLAQPL*
Ga0126360_10167391	3300010854	Boreal Forest Soil	SWDAGGGRKKIVGVPRIIPGDWGKAESGWLTQPL*
Ga0126360_10634831	3300010854	Boreal Forest Soil	SWSAGNGRKKVKGVPRIIPGDWGKVGPGWLAQPLEDGFARD*
Ga0126354_11142591	3300010857	Boreal Forest Soil	SWGAGSGRKKVKGVPRIIPGDWGKVGPGWLAQPLEDGFARD*
Ga0126354_11635001	3300010857	Boreal Forest Soil	NWDAGSGRKKVFGMPEIIPGDWGKVEPGWLAQPL*
Ga0126345_10064121	3300010858	Boreal Forest Soil	KSWSDGGGRKKIAGVPRIIPGDWGKVESGWLAQPL*
Ga0126345_11732571	3300010858	Boreal Forest Soil	SWSDGGGRKKIAEAPRIIPGDRGKVELGWLARPL*
Ga0126352_10249901	3300010859	Boreal Forest Soil	SWKAGNGRKKVAGLPRIIPGNWGKVEPGWLAQPL*
Ga0126352_11550051	3300010859	Boreal Forest Soil	SWNDGGGRKKIVGVPRIIPGDWGKVESGWLARPL*
Ga0126352_11907201	3300010859	Boreal Forest Soil	ELDAGKGRKKLFGTPWIIPGDWGKVEPGWLAQPL*
Ga0126351_10071831	3300010860	Boreal Forest Soil	NPEARGGRKKVAGVSRIIPGDWGKVEPGWLAQPL*
Ga0126351_10492681	3300010860	Boreal Forest Soil	SWDAGDGRKKVGGIPRIIPGDWGKVEAGWLAQPL*
Ga0126351_10675921	3300010860	Boreal Forest Soil	SWNDGGGRKKIVGVPRIIPGDWGKVESGWLAQPL*
Ga0126351_11473981	3300010860	Boreal Forest Soil	KNWDAGSGRKKVFGMPEIIPGDWGKVEPGWLAQPL*
Ga0126351_11805811	3300010860	Boreal Forest Soil	SWDTGDGRKKVACVPRIIPGDWGKDEPGWLAQPL*
Ga0126351_11833081	3300010860	Boreal Forest Soil	SWDAGDGRKKVAGVPRIIPGDWGKVETGWLAQPL*
Ga0126351_12338661	3300010860	Boreal Forest Soil	SWKSGDGRKKVVDLPRIIPGDWGKDGLDWLVHPL*
Ga0126351_13156261	3300010860	Boreal Forest Soil	SWDAGGGRKKVAGIPRIIPGDWGKDGPDWLAHPL*
Ga0126348_10158741	3300010862	Boreal Forest Soil	SWDAGGGRKKIAGIPRIIPGDWGKAESGWLAQPL*
Ga0126357_11439911	3300010864	Boreal Forest Soil	SWDAGNGRKKVAGVPRIIPGDWGKDEPGWLAQPL*
Ga0126357_11497201	3300010864	Boreal Forest Soil	SWNAAGGRKKISGIPRIIPGDWGKVETGWLAQPL*
Ga0126357_12166491	3300010864	Boreal Forest Soil	SWNEGGGRKKTESIPRIIPGDWGKAEPGWLAQPL*
Ga0126346_10615861	3300010865	Boreal Forest Soil	SWSEDGGRKKTGSAPRIIPGDWGKAEPGWLAQPL*
Ga0126347_10991291	3300010867	Boreal Forest Soil	WSAGSGRKKVKGVPRIIPGDWGKVGPGWLAQPLEDGFARD*
Ga0126347_13696081	3300010867	Boreal Forest Soil	SWDAGGGRKKVAGVPRIIPGDWGKVESGWLAQPL*
Ga0126359_11088231	3300010869	Boreal Forest Soil	KSWDAGNGRKKVAGVPRIIPGDWGKDEPGWLAQPL*
Ga0126359_13684321	3300010869	Boreal Forest Soil	SWDAGGGRKKVAGVPRIIPGDWGKAESGWLAQPL*
Ga0126356_108848251	3300010877	Boreal Forest Soil	SWNAGGGRKKVTGVPRIIPGDWGMIEAGWLAQSL*
Ga0138596_1036001	3300011014	Peatlands Soil	SWNAGGGRKKIVGVPRIIPGDWGKAESGWLPQPL*
Ga0138596_1065451	3300011014	Peatlands Soil	KNLDAGGGRKKVFGIPEIIPGNWGKVEPGWLAQPL*
Ga0138596_1239151	3300011014	Peatlands Soil	SWSNGGGRKKVAETPRIIPGDWGMVEPGWLVQPL*
Ga0138535_1019731	3300011015	Peatlands Soil	SWDAGDGRKKIACVPRIIPGDWGKVEAGWLAQPL*
Ga0138602_1024051	3300011020	Peatlands Soil	SWNAGGGRKKIVGVPRIIPGDWGKAESGWLAQPL*
Ga0138602_1126651	3300011020	Peatlands Soil	NLDAGGGRKKVFGIPEIIPGNWGKVEPGWLAQPL*
Ga0138530_1033341	3300011024	Peatlands Soil	SWDAGGGRKKIVGVPRIIPGDWGKVEPGWLVRPL*
Ga0138551_1039381	3300011029	Peatlands Soil	SWDAGGGRKKIVGVPRIIPGDWGKAGLGWLAQPL*
Ga0138603_1252211	3300011030	Peatlands Soil	SWNAGGGRKKIAGVPRMIPGDWGKVESGWLAQPL*
Ga0138546_1061301	3300011032	Peatlands Soil	SWAAGGGRKNVAGRPRIIPGDWGKVGPDWLAHPL*
Ga0138546_1278301	3300011032	Peatlands Soil	SWDAGGGRKKIVGVPRIIPGDWVKVEPGWLVRPL*
Ga0138590_1300801	3300011036	Peatlands Soil	SWNEGGGRKKTAVVPRMIPGDWGKVEPGWLAQPL*
Ga0138587_1113931	3300011040	Peatlands Soil	SWDAGGGRKEIVGVPRIIPGDWGKAESVWLAQPL*
Ga0138591_1366141	3300011041	Peatlands Soil	SWDAGGGRKKVAGVPRIIPGDWGKVEAGWLAQPL*
Ga0138598_1370751	3300011045	Peatlands Soil	SWNAAADEKEAACVPRIIPGDWGMAESGWLAQPL*
Ga0138598_1438601	3300011045	Peatlands Soil	NPDARGGRKKVAGHPRIIPGDWGKVEPGWLAQPL*
Ga0138600_1194341	3300011046	Peatlands Soil	SWNAGDGRKKVAGVPRIIPGDWGKVEAGWLAQPL*
Ga0138600_1317231	3300011046	Peatlands Soil	KSWSNGGGRKKVAETPRIIPGDWGMVEPGWLVQPL*
Ga0138556_1481731	3300011048	Peatlands Soil	KSWAAGGGRKNVAGRPRIIPGDWGKVGPDWLAHPL*
Ga0138571_1211991	3300011050	Peatlands Soil	SWNAGGGRKKVVGVPRMIPGDWGKVESGWLAQPL*
Ga0138571_1265741	3300011050	Peatlands Soil	ELDAGGGRKKAFGIPEIIPGNWGKVGPGWLAQPL*
Ga0138540_1029621	3300011051	Peatlands Soil	SWDAGGGRKKIAGIPRIIPGDWGMAESGWLAQPL*
Ga0138540_1457211	3300011051	Peatlands Soil	SWDAGGGRKKIVGVPRIIPGDWGKVEPGWLAQPL*
Ga0138540_1745881	3300011051	Peatlands Soil	KELGCSGGRKKIVRVPRIIPGDWGKVEPGWLAQPL*
Ga0138531_1344991	3300011053	Peatlands Soil	SWSAGDGRKKVAGIPSIIPGDWGKVEAGWLAQPL*
Ga0138538_10258801	3300011056	Peatlands Soil	ELGCSGGRKKIVRVPRIIPGDWGKVEPGWLVQPL*
Ga0138597_10374501	3300011059	Peatlands Soil	SWKAGGGRKKVAGSPRIIPGDRGKDGSDWLAHPL*
Ga0138583_10548161	3300011060	Peatlands Soil	SWDDGGGRKKIAVVPRIIPGDWGKVESGWLAQPL*
Ga0138524_10301961	3300011066	Peatlands Soil	KSWDAGDGRKEIACVPRIIPGDWGKVEAGWLTQPL*
Ga0138594_11314641	3300011067	Peatlands Soil	SGDAGDGRKKIACVPRIIPGDWGKVEAGWLAQPL*
Ga0138592_10125502	3300011069	Peatlands Soil	SWDAGGGRKKIEGVPRIIPGDWGKVGPGWLARPLLSRIA*
Ga0138592_10685751	3300011069	Peatlands Soil	SWKDGGGRKKIVSLPRIIPGDRGKVESGWLAQPL*
Ga0138592_10763231	3300011069	Peatlands Soil	SWDVGGGRKKIVGVPRLIPGDWGKVEPGWLAQPL*
Ga0138595_10086181	3300011071	Peatlands Soil	KSWDAGGGRKKTDCVPRIIPGDWGKAESGWLAQPL*
Ga0138555_10030741	3300011075	Peatlands Soil	KSWDAGGGRKKIVGVPRIIPGDWGKAGLGWLAQPL*
Ga0138555_11222721	3300011075	Peatlands Soil	KSWDDGGGRKKIAVVPRIIPGDWGKVESGWLAQPL*
Ga0138555_11532441	3300011075	Peatlands Soil	SWDAGDGRKKIASIHRIIPGDWGKVEAGWLAQPL*
Ga0138574_10252141	3300011076	Peatlands Soil	NLVGGGGRKKVAVLPEIIPGDWGKDESGWLVHPP*
Ga0138565_10289522	3300011078	Peatlands Soil	SWGAGSGRKKVARIPRIIPGDWGKVEPGWLAQPL*
Ga0138560_10687531	3300011083	Peatlands Soil	ELECSGGRKEACGVPRIIPGDWGKAESGWLVRPL*
Ga0138560_10949631	3300011083	Peatlands Soil	ELECSGGRKKTVCVPRIIPGDWGKVESGWLIQPL*
Ga0138560_11052911	3300011083	Peatlands Soil	NRDAGDGRKKVLGMPEIIPGDWGKVEPGWLAQPL*
Ga0138562_10565571	3300011084	Peatlands Soil	SWSAGGGRKKIAGVPRIIPGDWGKAESGWLAQPL*
Ga0138576_10455251	3300011088	Peatlands Soil	KSWDAGGGRKKVAGVPRIIPGDWGKAGPGWLAQPL*
Ga0138573_10235361	3300011089	Peatlands Soil	SWKAGGGRKKIACFPRIIPGDWAMDRPDWLAYPL*
Ga0138573_11564541	3300011089	Peatlands Soil	SWDDGGGRKKIAVVPRIIPGDWGKVESGWLARPL*
Ga0138579_11076371	3300011090	Peatlands Soil	ELGCSGGRKKIMRVPRIIPGDWGKVEPGWLVLLL*
Ga0138578_11150691	3300011110	Peatlands Soil	ERRKSWDAGGGRKKIAGVPRIIPGDWGKAESGWLAQPL*
Ga0150983_116092171	3300011120	Forest Soil	KSWDAGSGRKKVDCVPRIIPGDWGKVESGWLTQPL*
Ga0150983_124882691	3300011120	Forest Soil	SWKNGGGRKKVLELPRIIPGDWGKVEPGWLARPL*
Ga0150983_127322151	3300011120	Forest Soil	SWDAGDGRKKVASIPRIIPGDWGKVEAGWLAQPL*
Ga0150983_127500311	3300011120	Forest Soil	SWDAGGGRKKVTRIPRIIPGDWGKGGPDWLAHPL*
Ga0150983_139843491	3300011120	Forest Soil	SWNASSGRKKIAGVPRIIPGDWGKAEPGWLVQPL*
Ga0150983_158993291	3300011120	Forest Soil	SWSGEDGRKKIDEAPRIIPGDWGKVESGWLAQPL*
Ga0150983_163262842	3300011120	Forest Soil	SWAAEGGRKKISGGPRIIPGDWGKVGPGWLAQPL*
Ga0150983_164417661	3300011120	Forest Soil	SWDAAGGRKKVNGIPRIIPGDWGKVETGWLAQPL*
Ga0150983_165213041	3300011120	Forest Soil	SWNDGGGRKKIAEVPRIIPGDWGKVESGWLAQPL*
Ga0150985_1044451981	3300012212	Avena Fatua Rhizosphere	SWDVGNGRKKVTDVPRIIPGDWGKVEPGWLAQPL*
Ga0150985_1085909331	3300012212	Avena Fatua Rhizosphere	SAGSGRKKVKGVPRIIPGDWGKVGPGWLAQPLEDGFARD*
Ga0134042_11249951	3300012373	Grasslands Soil	GRKKVKGVPRIIPGDWGKVGPGWLAQPLEDGFARD*
Ga0134045_14407752	3300012409	Grasslands Soil	SAGNGRKKVKGVPRIIPGDWGMVRPGWLAQPLEDGFARD*
Ga0150984_1037767361	3300012469	Avena Fatua Rhizosphere	AGSGRKKVKGVPRIIPGDWGKVGPGWLAQPLEDGFARD*
Ga0138269_12517471	3300012778	Freshwater Lake	SWDAGGGRKKIAGIPRIIPGDWGKVGAGWLAQPL*
Ga0181507_11063041	3300016705	Peatland	GGWNDGGGRKKIAGVPRIIPGDRGKVEPGWLAQPL
Ga0181507_11503701	3300016705	Peatland	KSWDAGGGRKKVAGVPRIIPGDWGKGGPGWLAQPL
Ga0184577_1097201	3300019160	Soil	KSWDAGDGRKKTAGIPRIIPGDWGKVEAGWLVQPL
Ga0184594_1071491	3300019181	Soil	KSWDAGGGRKKIARVPRIIPGDWGKDESGWLAQPL
Ga0184588_1458411	3300019186	Soil	KELDAGSGRKKVFGIPRIIPGDWGKVEPGWLAQPL
Ga0187799_12179291	3300019211	Peatland	KSWGAGGGRKKVAGIPRIIPGDWGKAGSGWLAQPL
Ga0187798_18708081	3300019275	Peatland	KSGSAGGGRKEIVGVPRIIPGDWGKVGPGWLVQPL
Ga0187800_12791811	3300019278	Peatland	KSWDAEGGRKKVDGVPRIIPGDWGKVGPGWLAQPL
Ga0187800_15450501	3300019278	Peatland	KSWDAGGGRKKIVGVPRIIPGDWGKVEPGWLVRPL
Ga0187797_12938491	3300019284	Peatland	KSWDAGGGRKKIASVPRIIPGDWGKAESGWLVQPL
Ga0179585_11192971	3300021307	Vadose Zone Soil	WGAGNGRKKVKGVPRIIPGDWGKVGPGWLAQPLEDGFARD
Ga0213849_10621671	3300021857	Watersheds	TEAVKVGRKKVEKASVIIPGDWGRVGPGWLAQPLEC
Ga0213849_11691621	3300021857	Watersheds	KSWNEGGGRKKIAGVPRIIPGDWGKVESGWLAQPL
Ga0213853_105731991	3300021861	Watersheds	RAAMPEGGRKEAQRVARIIPGDWGMAEPGWLAHPL
Ga0242644_10082111	3300022498	Soil	AEGGRKKISGAPRIIPGDWGKVESGWLTQPLKRARKG
Ga0242646_10087931	3300022502	Soil	WNAEGGRKKISGAPRIIPGDWGKVESGWLTQPLKRARKG
Ga0242649_10168711	3300022509	Soil	LNLSPVTWDYPWNAGDGRKKVAGVPRIIPGDWGKVEAGWLAQPL
Ga0242659_11126601	3300022522	Soil	KSWNEGGGRKKIVGFPRMIPGDWGKAESGWLAQPL
Ga0242656_10445091	3300022525	Soil	WNAEGGRKEISGDPRIIPGDWGKVESGWLTQPLKRARKG
Ga0242668_10537721	3300022529	Soil	INQAPRWDAGDGRKKVAGVPRIIPGDWGKAGPGWLAQPL
Ga0242670_10185501	3300022708	Soil	LGWDAGDGRKKVAGVPRIIPGDWGKAGPGWLAQPL
Ga0242670_10737531	3300022708	Soil	TWDYPWNAGGGRKKIVGVPRIIPGDWGKAESGWLAQPL
Ga0242670_10774551	3300022708	Soil	DGIGRKKVNVVPRIIPGDWGKVEPGWLAQPLLNGFARDE
Ga0222756_10300021	3300022709	Soil	KSWDAGDGRKKVAGVPRIIPGDWGKAGPGWLAQPL
Ga0242674_10240131	3300022711	Soil	KSWNAGGGRKKIVCAPRIIPGDWAMAEPGWLAQPL
Ga0242653_10305591	3300022712	Soil	GIGRKKVTVVPRIIPGDWGKVEPGWLAQPLLNGFARDE
Ga0242671_10285921	3300022714	Soil	KSWSGEDGRKKIDEAPRIIPGDWGKVESGWLAQPL
Ga0247552_1030431	3300023536	Soil	KSWDAGGGRKKIVGVPRIIPGDWGKAESGWLAQPL
Ga0247544_1005681	3300023541	Soil	KSWNEGGGRKKIAGIPRIIPGDWGTVESGWLAQPL
Ga0247546_1012761	3300023551	Soil	IGRFRKVGWDAGGGRKKIAGVPRIIPGDWGKAESGWLAQPL
Ga0247539_1008941	3300023669	Soil	KELGAGGGRKKIAGIPRIIPGDWGKAESGWLAQPL
Ga0255301_10437451	3300024553	Freshwater	LGNRSGCGGREKVVEVPRIIPGDWGKAGTGWLARPL
Ga0189898_10180381	3300028450	Peatlands Soil	KSWDAGGGRKKIVGVPRIIPGDWGKAESGWLVQPL
Ga0222748_10894881	3300029701	Soil	KSWNAGGGRKKIIGVPRIIPGDWGKVESGWLAQPL
Ga0210274_13232541	3300030531	Soil	PKSWDAGSGRKKVAGVPRIIPGDWGMVEAGWLAQPL
Ga0210252_110980281	3300030548	Soil	RKSWSAGDGRKKVTGIPRIIPGDWGKVETGWLAQPL
Ga0210261_10649851	3300030582	Soil	KSWNAGGGRKKIVSVPRIIPGDWGKAESGWLAQPL
Ga0210269_102973721	3300030627	Soil	FIERAGTQGGGRKKIAGVPRIIPGDWGKAESGWLAQPL
Ga0210268_11303351	3300030629	Soil	KSWIAGDGRKKVAGFPRIIPGDWGTVEAGWLAQPL
Ga0307920_1308251	3300030716	Soil	SWSAGSGRKKVKGVPRIIPGDWGKVRPGWLAQPLEDGFARD
Ga0307482_10855571	3300030730	Hardwood Forest Soil	KSWDAGGGRKKVAGIPRIIPGDWGKVEAGWLAQSL
Ga0307482_11161131	3300030730	Hardwood Forest Soil	SWNAEGGRKKISGAPRIIPGDWGKVESGWLTQPLKRARKG
Ga0265722_1023851	3300030761	Soil	WNAADGRKKVGGVPRIIPGDWGKVESGWLTQPLKRP
Ga0265775_1032441	3300030762	Soil	KSWGAVGGRKKISGIPRIIPGDWGKVEAGWLAQPL
Ga0075402_124976841	3300030777	Soil	GAGSGRKKVKGVPRIIPGDWGKVRPGWLAQPLEDGFARD
Ga0265767_1047061	3300030836	Soil	DAADGRKKISGVPRIIPGDWGKVESGWLTQPLKRP
Ga0075392_113116001	3300030843	Soil	QESWNAAGGRKKVGGIPRIIPGDWGKVESGWLAQPL
Ga0265742_10180741	3300030874	Soil	KSWDAGSGRKKIAGVPRIIPGDWGKVETGWLAQPL
Ga0308202_11621832	3300030902	Soil	WGAGNGRKKVKGVPRIIPGDWGKVRPGWLAQPLEDGFARN
Ga0265740_10115771	3300030940	Soil	KSWNAGSGRKKIAGVPRIIPGDWGKAESGWLAQPL
Ga0247549_1016651	3300030942	Soil	LCEGRPGWNAGGGRKEIVGVPRIIPGDWGKAESGWLAQPL
Ga0265768_1038901	3300030963	Soil	SSDLAGMQGDGRKKIAGVPRIIPGDWGKAESGWLAQPL
Ga0099845_10264661	3300030975	Boreal Forest Soil	PFSWRAGNGRKKVAGLPRIIPGNWGKVEPGWLAQPL
Ga0308183_12169401	3300030988	Soil	STEMEGGGRKKVAENLRIIPGDRGKVEPGWLAGPL
Ga0308178_10757651	3300030990	Soil	GRKKVKGVPRIIPGDWGKVRPGWLAQPLEDGFARD
Ga0265771_10029901	3300031010	Soil	KSWNAGDGRKKVAGVPRIIPGDWGKAGPGWLAQPL
Ga0265755_1061431	3300031041	Soil	ADGRKKVGGVPRIIPGDWGKVESGWLTQPLKRARKG
Ga0170834_1099739261	3300031057	Forest Soil	GSGRKKVKGVPRIIPGDWGKVRPGWLAQPLEDGFARD
Ga0265760_101309671	3300031090	Soil	KSWSAGDGRKKVAGIPRIIPGDWGKVETGWLAQPL
Ga0308187_101359251	3300031114	Soil	WSAGSGRKKVKGVPRIIPGDWGKVRPGWLAQPLEDGFARD
Ga0308194_101724011	3300031421	Soil	GSGRKKGKGVPRIIPGDWGKVGPGWLAQPLEDGFARD
Ga0307483_10101691	3300031590	Hardwood Forest Soil	WNAEGGRKEISGDPRIIPGDWGQVESGWLTQPLKRARKG
Ga0310117_1290721	3300031592	Soil	KSWSDGNGRKKVEGTPRIIPGDRGKVESGWLAQPL
Ga0316048_1036751	3300031809	Soil	LHSLKELGAGGGRKKIAGIPRIIPGDWGKAESGWLAQPL
Ga0316053_1053161	3300032120	Soil	KSWNAIGGRKKISGIPRIIPGDWGKVEAGWLAQPL
Ga0316040_1046641	3300032121	Soil	GPEITRWNEGGGRKKIVGFPRIIPGDWGKAESGWLAQPL
Ga0370544_06795_1_108	3300034447	Soil	STETDSGGRKKVAENLRIIPGNRGKVEPGWLARPL

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.15
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.15
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F033813

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign